| Parametereinstellungen | |||
| Synonymic Value: | 1.1700 | ||
| Non-Synonymic Value: | 3.0000 | ||
| Blast-Hit-End Value: | -9.1000 | ||
| Query Stop-Codon Value: | -3.0000 | ||
| Hit Stop-Codon Value: | -3.9800 | ||
| Frameshift-Span: | 217.0000 | ||
| Prediction-Span: | 368.0000 | ||
| Leavegene-Value: | -1.3000 | ||
| cURL-DB: | nucleotide | ||
| Output-Filename: | Metagenome_454 | ||
| Output-Fileformat (1/2/3): |
2 | ||
| Hitfile (yes=1/no=0): |
1 | ||
| Min-Protein-Length (>=15): |
15 | ||
| Min-Result-Percentage: | 0.0500 | ||
| Extended-Modus (yes=1/no=0): |
1 | ||
| Homology-Modus (yes=1/no=0): |
0 | ||
| Codon-Modus (1/2/3): |
3 | ||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_001|beg|888|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtggg | |||
| Protein-Sequence | |||
| GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWV | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613 | |||
| gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_002|beg|758|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_003|beg|1382|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_005|beg|1748|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt | |||
| Protein-Sequence | |||
| KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF | |||
| Hit-Information Section | |||
| gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_007|beg|433|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_009|beg|558|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_011|beg|1241|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_012|beg|1105|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_013|beg|1597|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_015|beg|106|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_018|beg|969|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_020|beg|737|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_021|beg|24|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
| Protein-Sequence | |||
| FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686 | |||
| gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_024|beg|1651|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_025|beg|364|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_027|beg|980|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_028|beg|91|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_030|beg|369|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_031|beg|1449|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg | |||
| Protein-Sequence | |||
| LELVKKANLIIYSERLKRK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_032|beg|1594|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_034|beg|1680|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_035|beg|403|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
| Protein-Sequence | |||
| SSRSLNVSILVFPVTRPLSR | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 6 from: 172424 to: 172495 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_036|beg|927|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
| Protein-Sequence | |||
| LSYARICPNPPRRNVRVKDCIKEH*S | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_037|beg|1378|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_041|beg|1320|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_045|beg|1544|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_046|beg|21|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_047|beg|1222|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_049|beg|969|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_053|beg|875|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_055|beg|880|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_057|beg|596|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_060|beg|428|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_061|beg|941|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_067|beg|463|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG | |||
| Hit-Information Section | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_068|beg|832|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_069|beg|1530|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_071|beg|1193|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_074|beg|1168|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_075|beg|616|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_076|beg|257|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_077|beg|136|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_079|beg|399|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_080|beg|172|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat | |||
| Protein-Sequence | |||
| ILREELGFNDIHIIYSGRGYPY*S | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322 | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_084|beg|1347|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_085|beg|335|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_086|beg|1748|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_088|beg|1859|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_089|beg|41|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_093|beg|1523|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_094|beg|1505|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_096|beg|1310|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_098|beg|863|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattatttatcggtaaaatttcctcagttTattactctaatgtcctttata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt | |||
| Protein-Sequence | |||
| IIEAANRCSPPLFRGSNPMRSR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_100|beg|1440|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_101|beg|1647|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_102|beg|1434|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_103|beg|447|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_104|beg|1722|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_106|beg|346|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_108|beg|341|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_114|beg|1699|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_115|beg|897|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_116|beg|1617|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_121|beg|748|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg | |||
| Protein-Sequence | |||
| PGGISAVFEARICCIIQIRGGTRYS*S | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_122|beg|1722|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_123|beg|1128|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_124|beg|1098|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_128|beg|232|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_129|beg|1356|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_130|beg|551|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_131|beg|98|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg | |||
| Protein-Sequence | |||
| SFLNSSTSSISLAETNDKNSFPWTSNLA*G | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT | |||
| Protein-Sequence | |||
| MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_132|beg|1398|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_133|beg|369|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc | |||
| Protein-Sequence | |||
| HLCQRRVQSLTHPSISWGF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Coding-DNA |
|||
| gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta | |||
| Protein-Sequence | |||
| SATLGINGIGGLWPLCNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_135|beg|1183|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP | |||
| Hit-Information Section | |||
| gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932 | |||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_137|beg|1246|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_142|beg|1222|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_143|beg|627|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_144|beg|667|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_145|beg|787|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_148|beg|628|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_149|beg|1569|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_150|beg|956|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_151|beg|401|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_153|beg|598|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_159|beg|1496|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_161|beg|141|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_165|beg|1453|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | read_167|beg|1547|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_001|beg|888|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtggg | |||
| Protein-Sequence | |||
| GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWV | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613 | |||
| gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_002|beg|758|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_003|beg|1382|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_005|beg|1748|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt | |||
| Protein-Sequence | |||
| KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF | |||
| Hit-Information Section | |||
| gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_007|beg|433|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_009|beg|558|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_011|beg|1241|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_012|beg|1105|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_013|beg|1597|length|0|reverse|gi | ||
| Query_DNA-Sequence | |||
| cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_017|beg|1014|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_019|beg|1097|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_020|beg|737|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_023|beg|307|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
| Protein-Sequence | |||
| FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686 | |||
| gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_024|beg|1651|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_026|beg|1|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_027|beg|980|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_029|beg|787|length|99|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_030|beg|369|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_031|beg|1449|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg | |||
| Protein-Sequence | |||
| LELVKKANLIIYSERLKRK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_032|beg|1594|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_034|beg|1680|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_035|beg|403|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
| Protein-Sequence | |||
| SSRSLNVSILVFPVTRPLSR | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 6 from: 172424 to: 172495 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_036|beg|927|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
| Protein-Sequence | |||
| LSYARICPNPPRRNVRVKDCIKEH*S | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_039|beg|348|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_044|beg|1656|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_045|beg|1544|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_046|beg|21|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_048|beg|1471|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_050|beg|1088|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_053|beg|875|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_055|beg|880|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_057|beg|596|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_060|beg|428|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_061|beg|941|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_067|beg|463|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG | |||
| Hit-Information Section | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_068|beg|832|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_069|beg|1530|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_071|beg|1193|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_074|beg|1168|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_075|beg|616|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_076|beg|257|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_077|beg|136|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_079|beg|399|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_080|beg|172|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat | |||
| Protein-Sequence | |||
| ILREELGFNDIHIIYSGRGYPY*S | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322 | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_084|beg|1347|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_085|beg|335|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_086|beg|1748|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_088|beg|1859|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_089|beg|41|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_093|beg|1523|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_094|beg|1505|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_096|beg|1310|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_098|beg|863|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattaTttatcggtaaaatttcctcagttTattactctaatgtcctttata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt | |||
| Protein-Sequence | |||
| IIEAANRCSPPLFRGSNPMRSR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_100|beg|1440|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_101|beg|1647|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_102|beg|1434|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_103|beg|447|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_104|beg|1722|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_106|beg|346|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_108|beg|341|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_114|beg|1699|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_115|beg|897|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_116|beg|1617|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_121|beg|748|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg | |||
| Protein-Sequence | |||
| PGGISAVFEARICCIIQIRGGTRYS*S | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_122|beg|1722|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_123|beg|1128|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_124|beg|1098|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_128|beg|232|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_129|beg|1356|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_130|beg|551|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_131|beg|98|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg | |||
| Protein-Sequence | |||
| SFLNSSTSSISLAETNDKNSFPWTSNLA*G | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT | |||
| Protein-Sequence | |||
| MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_132|beg|1398|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_133|beg|369|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc | |||
| Protein-Sequence | |||
| HLCQRRVQSLTHPSISWGF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Coding-DNA |
|||
| gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta | |||
| Protein-Sequence | |||
| SATLGINGIGGLWPLCNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_135|beg|1183|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP | |||
| Hit-Information Section | |||
| gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932 | |||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_137|beg|1246|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_142|beg|1222|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_143|beg|627|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_144|beg|667|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_145|beg|787|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_148|beg|628|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_149|beg|1569|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_150|beg|956|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_151|beg|401|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_153|beg|598|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_159|beg|1496|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_161|beg|141|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_165|beg|1453|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_167|beg|1547|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcacaagttcgagttctatTaccatagggtgagtaggatagggcccccc | |||
| Protein-Sequence | |||
| HKFEFYYHRVSRIGPP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 173566 to: 173595 | |||
Coding-DNA |
|||
| tcacaagttcgagttctatTaccatagggtgagtaggatagggcccccc | |||
| Protein-Sequence | |||
| HKFEFYYHRVSRIGPP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 173566 to: 173595 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_001|beg|2512|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| tctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttgacc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttga | |||
| Protein-Sequence | |||
| GQGDGERNKIFAEAFGRDAEFFAFYRAMQAYETAFNWWNR | |||
| Hit-Information Section | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417142 to: 2417237 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610373 to: 3610468 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_002|beg|2211|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaaaatataataaaataattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccacttcttaatttgtgaatcTtttatcatctTccatttttttttaacat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_007|beg|268|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| taaattcagatttagtcttagctaaccaatcatacatagatatattgtataagatttaatctcataagctcttatggactttggtatcatttggatcaaatttgtct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_011|beg|1665|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt | |||
| Protein-Sequence | |||
| KQELGDWVIAIGNPFGLGGTVTAGIIQQEIDQSDCLRYKL | |||
| Hit-Information Section | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887137 to: 1887214 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 2 from: 2802806 to: 2802883 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355953 to: 1356030 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349251 to: 1349328 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8553 to: 8630 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367346 to: 1367423 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364496 to: 1364573 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 489285 to: 489362 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836329 to: 2836406 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456492 to: 3456569 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165081 to: 7165158 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785844 to: 5785915 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683226 to: 683303 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219544 to: 3219621 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322989 to: 6323066 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 3168642 to: 3168713 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946774 to: 2946851 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757259 to: 5757336 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151682 to: 2151759 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418444 to: 2418521 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250103 to: 2250180 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713911 to: 3713988 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997510 to: 1997587 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609103 to: 3609180 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3949530 to: 3949607 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168194 to: 1168262 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320873 to: 2320950 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246280 to: 246357 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 550628 to: 550705 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71227 to: 71304 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62585 to: 62662 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 848 to: 925 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 821 to: 898 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667639 to: 1667716 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 2 from: 164754 to: 164825 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432575 to: 432640 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367887 to: 6367964 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211350 to: 1211427 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 3977259 to: 3977324 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663790 to: 2663867 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 1013990 to: 1014058 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617902 to: 2617979 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552048 to: 3552125 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917630 to: 3917698 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625378 to: 1625455 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 3004488 to: 3004565 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340230 to: 1340298 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294304 to: 2294381 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266551 to: 266619 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170820 to: 170888 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497381 to: 1497449 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 3402718 to: 3402786 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991977 to: 992045 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1866553 to: 1866621 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5742 to: 5819 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966525 to: 966602 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 2002161 to: 2002229 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556193 to: 2556261 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563305 to: 1563382 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 2 from: 867750 to: 867815 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973562 to: 2973639 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302025 to: 1302102 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205095 to: 2205163 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 1038097 to: 1038165 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99410 to: 99487 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69430 to: 69507 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838175 to: 3838243 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1347106 to: 1347171 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 464956 to: 465033 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434048 to: 434119 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360580 to: 2360648 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933533 to: 1933604 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6508 to: 6576 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 1481604 to: 1481672 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472412 to: 1472477 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119358 to: 1119435 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299953 to: 300030 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 525 to: 596 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360485 to: 360556 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 812523 to: 812594 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209940 to: 1210008 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455231 to: 2455302 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193379 to: 1193447 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206735 to: 1206803 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852865 to: 852936 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707251 to: 1707316 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968960 to: 969028 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730842 to: 4730913 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 752 to: 820 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227875 to: 3227946 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192123 to: 2192200 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634431 to: 634499 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970353 to: 970424 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79057 to: 79128 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967615 to: 967686 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927065 to: 927130 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881028 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90043 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273794 to: 273865 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219050 to: 219121 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946806 to: 946877 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246511 to: 246582 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124538 to: 1124609 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120943 to: 1121014 | |||
| gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 896671 to: 896742 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576887 to: 576955 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725706 to: 1725771 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427034 to: 427102 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780576 to: 1780644 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799750 to: 2799818 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750324 to: 2750392 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837587 to: 2837655 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462275 to: 2462343 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564603 to: 564671 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210100 to: 3210168 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 501552 to: 501617 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647528 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777118 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2244783 to: 2244854 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939965 to: 2940033 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934462 to: 1934530 | |||
| gi-nr: gi|33238865 gi_def: Prochlorococcus marinus subsp. marinus str. CCMP1375 complete genome hsp_num: 1 from: 116489 to: 116560 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 1119186 to: 1119251 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3095258 to: 3095326 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696481 to: 696546 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 2 from: 754658 to: 754723 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 3267195 to: 3267266 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 559 to: 627 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978033 to: 3978101 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7924 to: 7992 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 953 to: 1021 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242058 to: 242126 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249322 to: 249390 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242049 to: 242117 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241163 to: 241231 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 335 to: 373 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829861 to: 829929 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619717 to: 3619785 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239147 to: 3239215 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913587 to: 3913655 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651877 to: 3651945 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796537 to: 796605 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903457 to: 3903525 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259710 to: 259778 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343281 to: 1343352 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428584 to: 1428649 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1933 to: 1998 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688687 to: 688752 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087596 to: 4087664 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 3457286 to: 3457351 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253502 to: 253570 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142957 to: 143022 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79450 to: 79515 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146093 to: 146158 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 1583819 to: 1583884 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252713 to: 252781 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502816 to: 2502884 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1374 to: 1442 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531144 to: 531212 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369821 to: 369889 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53608 to: 53679 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979313 to: 3979381 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350811 to: 4350879 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481613 to: 2481678 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189185 to: 4189253 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935880 to: 3935948 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149077 to: 149145 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180877 to: 4180945 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16885 to: 16953 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 100 to: 138 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264307 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264227 to: 1264265 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 514 to: 582 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767214 to: 5767279 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808372 to: 808437 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238515 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147992 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147452 to: 147490 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914076 to: 914141 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4770 to: 4808 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191807 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226813 to: 226881 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_012|beg|1640|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| gagtttattgTatgcatcagtttgaatgtaatcttTcaTtaacgagacagtTccgattgatcTtatttcttgctgatattattcctcagtaaccgttcctcctaagccaaaggggattgccgattgcgataacc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_013|beg|638|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| atataaatgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttgtaaacctgcatactgtTcggattgatgattttctccttcaatttttttttgcaatctta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_014|beg|1004|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| taatctattgggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_015|beg|776|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| tgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagTcttaacaccaatatatcTttcttggttttgattattgtaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_016|beg|2747|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc | |||
| Protein-Sequence | |||
| ESFGIKIVDVRIKRADLPQANSDAIYRRIRLKGK | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797881 to: 797970 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205782 to: 1205871 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 11010 to: 11093 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011138 to: 1011221 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353700 to: 1353789 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080087 to: 1080176 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 582399 to: 582482 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2619018 to: 2619065 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_017|beg|456|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaatttttaactagTtccattgattaatgattgaaaatatagacctgttccaccTaactaaaattggaattttttttctttttttTgaatat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_018|beg|2521|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| caaTttaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaatttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTcaccttgacccTttcatg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc | |||
| Protein-Sequence | |||
| NLHLFQRLLQKILFLSPF | |||
| Hit-Information Section | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107 | |||
Coding-DNA |
|||
| ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc | |||
| Protein-Sequence | |||
| MHRSVESKKFASLPKASAKDLISFTIH | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_020|beg|1843|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| gactgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgattaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| actgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgatt | |||
| Protein-Sequence | |||
| LQYQDKGSAPTTVALYSLSPSTRTKISSAFCNNMIVSD* | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_024|beg|2741|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaacatctactattttaattccaaaactttcagct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca | |||
| Protein-Sequence | |||
| MLELKEADLPQSNSDAIYRRMQTEREREA | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197 | |||
| gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77 | |||
Coding-DNA |
|||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca | |||
| Protein-Sequence | |||
| MLELKEADLPQSNSDAIYRRMQTEREREA | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197 | |||
| gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_025|beg|2094|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacTttattgcaaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISTTTTVTT | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Coding-DNA |
|||
| tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISTTTTVTT | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_026|beg|2198|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaactttttatataccaataattataaaaaccTtataactgcaaaaattaacccaccacttcttaattgtgaatcttttaTtcTatc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_027|beg|1217|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| gtaatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatttttcatctctttaatcttagtgttattaaactcta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatt | |||
| Protein-Sequence | |||
| NLSFISPDFNIYYVLPTSVCATIIGKF | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_028|beg|32|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| aattgatattaactTcttctgcttTcatccaaggtaaTtttcatcaTtttagatTactgtgtcaattcggcaatcccaaTttaccttgtttacactctgatTcttttttaatttttagtttaagaaattttttaact | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_029|beg|2108|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gtcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgaaaacttattgcaaaaaatataata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISKR | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Coding-DNA |
|||
| tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISKR | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_030|beg|1689|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| cgattgatctatttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataacccaatcaccaattcttgcttgatcTagaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc | |||
| Protein-Sequence | |||
| LGYAIGNPFGLGGTVTAGIISKK*I | |||
| Hit-Information Section | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792 | |||
| gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209 | |||
| gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529 | |||
| gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973 | |||
| gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 2663817 to: 2663870 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2961597 to: 2961650 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925 | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606 | |||
| gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656 | |||
| gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325 | |||
| gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172 | |||
| gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648 | |||
| gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573 | |||
| gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784 | |||
| gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285 | |||
| gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779 | |||
| gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658 | |||
| gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455 | |||
| gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695 | |||
| gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634 | |||
| gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686 | |||
| gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616 | |||
| gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670 | |||
| gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876 | |||
| gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886 | |||
| gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378 | |||
| gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585 | |||
| gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586 | |||
| gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726 | |||
| gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581 | |||
| gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227 | |||
| gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696 | |||
| gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959 | |||
| gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755 | |||
| gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415 | |||
| gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669 | |||
| gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666 | |||
| gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195 | |||
| gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595 | |||
| gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162 | |||
| gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389 | |||
| gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876 | |||
| gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411 | |||
| gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034 | |||
| gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890 | |||
| gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780 | |||
| gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440 | |||
| gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515 | |||
| gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335 | |||
| gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251 | |||
| gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519 | |||
| gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488 | |||
| gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448 | |||
| gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602 | |||
| gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869 | |||
| gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423 | |||
| gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002 | |||
| gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779 | |||
| gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739 | |||
| gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130 | |||
| gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368 | |||
| gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769 | |||
Coding-DNA |
|||
| tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc | |||
| Protein-Sequence | |||
| LGYAIGNPFGLGGTVTAGIISKK*I | |||
| Hit-Information Section | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792 | |||
| gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209 | |||
| gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529 | |||
| gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973 | |||
| gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 2663817 to: 2663870 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2961597 to: 2961650 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925 | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606 | |||
| gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656 | |||
| gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325 | |||
| gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172 | |||
| gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648 | |||
| gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573 | |||
| gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784 | |||
| gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285 | |||
| gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779 | |||
| gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658 | |||
| gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455 | |||
| gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695 | |||
| gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634 | |||
| gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686 | |||
| gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616 | |||
| gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670 | |||
| gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876 | |||
| gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886 | |||
| gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378 | |||
| gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585 | |||
| gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586 | |||
| gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726 | |||
| gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581 | |||
| gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227 | |||
| gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696 | |||
| gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959 | |||
| gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755 | |||
| gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415 | |||
| gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669 | |||
| gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666 | |||
| gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195 | |||
| gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595 | |||
| gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162 | |||
| gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389 | |||
| gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876 | |||
| gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411 | |||
| gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034 | |||
| gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890 | |||
| gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780 | |||
| gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440 | |||
| gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515 | |||
| gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335 | |||
| gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251 | |||
| gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519 | |||
| gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488 | |||
| gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448 | |||
| gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602 | |||
| gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869 | |||
| gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423 | |||
| gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002 | |||
| gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779 | |||
| gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739 | |||
| gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130 | |||
| gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368 | |||
| gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_031|beg|835|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaatctagcttaacaccaatTatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgattagaTttttaaaacagtTgcctacaatatcttcaagatctttagtagattttatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_033|beg|443|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tagtctaactttatttctaaacttaagaggtatctctggaattttaatagtccattgatttaatgattgaaaatatagacctgttccaccaactaaaattggaatttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_034|beg|1399|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tgctcctctaggttcatctaatttttcaacttcaTgcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcTaccaaattctat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt | |||
| Protein-Sequence | |||
| MVETKRGWLGVRIQVVSEEIA | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 5432 to: 5488 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448 | |||
Coding-DNA |
|||
| aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt | |||
| Protein-Sequence | |||
| MVETKRGWLGVRIQVVSEEIA | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 5432 to: 5488 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_035|beg|275|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| agatttagtcttagctaaccaatcatacatagatatatttgtataagatttaatctcataaTgctcttatggatctttgagtatcattttTggatcaaatttgTtctttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_036|beg|2480|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| gaattcactgtcagggtgataaaattaaagatTgtctgtccaccaattaaagcagtttcataggcttgcatcgcTtctgtagaaagcaaaaaattctgcatctcttccaaaaggcttctgcaaagatcttatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_043|beg|1462|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aacacccagccatcctcttttagttttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagagccTacctttacccaaaattgctgtgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag | |||
| Protein-Sequence | |||
| GSIGIGFSIPSNDAKRVVNQLIEFGE | |||
| Hit-Information Section | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912 | |||
| gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282 | |||
Coding-DNA |
|||
| tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag | |||
| Protein-Sequence | |||
| GSIGIGFSIPSNDAKRVVNQLIEFGE | |||
| Hit-Information Section | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912 | |||
| gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_044|beg|2597|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aaagatcttatttctttcaccatcaccttgaccccttcatTatttcagattctttattagcatttgctaaaattacagaaacatctttgtctgcagttgaagtaattgtaaccgccatctct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_045|beg|1646|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| attgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca | |||
| Protein-Sequence | |||
| GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS | |||
| Hit-Information Section | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383 | |||
| gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066 | |||
| gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057 | |||
| gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972 | |||
| gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462 | |||
| gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297 | |||
Coding-DNA |
|||
| ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca | |||
| Protein-Sequence | |||
| GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS | |||
| Hit-Information Section | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383 | |||
| gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066 | |||
| gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057 | |||
| gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972 | |||
| gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462 | |||
| gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_048|beg|1081|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| atcttcatcattcaatggtcttacaattatttttaaagatttaatttcagaaattttcaggtgtttcttctttagtttcttttttttctactttaaaatccctctgaagtttcaagtcttcctagttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_049|beg|1380|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcaacactagTcaactaatgctcctctaggttcatctaatttttcTaacttcagcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa | |||
| Protein-Sequence | |||
| LIEFGETKRGWLGVRIQVVSEENC*S | |||
| Hit-Information Section | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69154 to: 69219 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6232 to: 6297 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001885 to: 2001950 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866277 to: 1866342 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065284 to: 2065349 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195428 to: 195493 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057219 to: 2057284 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396056 to: 1396121 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209735 to: 3209800 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887425 to: 1887490 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402442 to: 3402507 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904832 to: 904897 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117885 to: 2117950 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085398 to: 2085463 | |||
| gi-nr: gi|2094849 gi_def: R.capsulatus fdxE gene hsp_num: 1 from: 1102 to: 1152 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_052|beg|57|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tccaaggtaatttcatatttagatactgtgtcaattcggcaatcccaattaccttgtttacactctgatctttttaatttttTagtttaagaaattttttaaacttcaga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_053|beg|2036|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| aacatatcttcaaaaggtgatcctgggggaaactgaaaaccaggaaatggTatttagaatttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_054|beg|1446|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| aaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttTgcatcgttcatggtattggaaaaacc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct | |||
| Protein-Sequence | |||
| MQKRVVNQLIEFGETKRGWLGVRIQVV | |||
| Hit-Information Section | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112 | |||
Coding-DNA |
|||
| aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct | |||
| Protein-Sequence | |||
| MQKRVVNQLIEFGETKRGWLGVRIQVV | |||
| Hit-Information Section | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_055|beg|1556|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| atagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgagtttattgatgcatcagtttgTaatg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgag | |||
| Protein-Sequence | |||
| TQENSGGPLFDMNGDVIGINTAILGKGGS | |||
| Hit-Information Section | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176455 to: 8176526 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 2 from: 3517066 to: 3517137 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 5328805 to: 5328876 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 4 from: 1070315 to: 1070380 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5482594 to: 5482665 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887290 to: 1887364 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355803 to: 1355877 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349101 to: 1349175 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8706 to: 8780 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367196 to: 1367270 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364346 to: 1364420 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395921 to: 1395995 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389165 to: 1389227 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367253 to: 1367315 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354728 to: 1354790 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 661 to: 735 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065410 to: 2065484 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195554 to: 195628 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402568 to: 3402642 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6358 to: 6432 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909749 to: 2909823 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002011 to: 2002085 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556043 to: 2556117 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2989359 to: 2989430 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 365565 to: 365636 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69280 to: 69354 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 6049720 to: 6049797 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9948 to: 10007 | |||
| gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 1734087 to: 1734161 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 688 to: 747 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012230 to: 1012289 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798982 to: 799041 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227725 to: 3227799 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515190 to: 3515261 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294445 to: 2294519 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 2987759 to: 2987821 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8023 to: 8097 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1210084 to: 1210155 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455093 to: 2455155 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16333 to: 16398 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888447 to: 888521 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958967 to: 4959038 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044380 to: 1044451 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1910105 to: 1910176 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548810 to: 1548881 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163662 to: 163736 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322611 to: 3322685 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355156 to: 3355230 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470794 to: 3470868 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391623 to: 391697 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 2 from: 2029969 to: 2030031 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349243 to: 349317 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190627 to: 190701 | |||
| gi-nr: gi|2062623 gi_def: Mycobacterium tuberculosis sigma factor SigE (sigE) and HtrA (htrA) genes, complete cds hsp_num: 1 from: 3088 to: 3144 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316866 to: 2316928 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 3 from: 1040311 to: 1040373 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193523 to: 1193585 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1081119 to: 1081181 | |||
| gi-nr: gi|32447713 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 22/24 hsp_num: 1 from: 37110 to: 37187 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 691053 to: 691112 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7720763 to: 7720825 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 5 from: 2481466 to: 2481525 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 6 from: 5421057 to: 5421116 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 7 from: 5699996 to: 5700058 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 3 from: 1234329 to: 1234391 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 3 from: 2622356 to: 2622418 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3858651 to: 3858722 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778195 to: 3778266 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127546 to: 1127617 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 92570 to: 92641 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4649671 to: 4649742 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 430500 to: 430559 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 1971130 to: 1971189 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 2 from: 301701 to: 301754 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 530991 to: 531065 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 369668 to: 369742 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3979460 to: 3979534 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 4350958 to: 4351032 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 4189032 to: 4189106 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 3936027 to: 3936101 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 149224 to: 149298 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 4181024 to: 4181098 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 688840 to: 688905 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 4 from: 3446891 to: 3446950 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 1 from: 27894 to: 27953 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 1 from: 27362 to: 27421 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 1 from: 332508 to: 332570 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 4 from: 1167588 to: 1167650 | |||
| gi-nr: gi|32448029 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 23/24 hsp_num: 1 from: 213562 to: 213627 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 1 from: 600903 to: 600965 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035561 to: 1035623 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4315831 to: 4315884 | |||
| gi-nr: gi|157313474 gi_def: Thermotoga lettingae TMO, complete genome hsp_num: 1 from: 426172 to: 426234 | |||
| gi-nr: gi|149792434 gi_def: Thermosipho melanesiensis BI429, complete genome hsp_num: 1 from: 1781964 to: 1782026 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653436 to: 3653492 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170642 to: 5170698 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 4 from: 4084087 to: 4084146 | |||
| gi-nr: gi|145358489 gi_def: Arabidopsis thaliana serine-type peptidase/ trypsin (AT5G27660) mRNA, complete cds hsp_num: 1 from: 902 to: 952 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 2 from: 4238430 to: 4238486 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 3 from: 922705 to: 922761 | |||
| gi-nr: gi|125860746 gi_def: Methanoculleus marisnigri JR1, complete genome hsp_num: 1 from: 1350874 to: 1350936 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 4829762 to: 4829818 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 2 from: 4292609 to: 4292665 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 3 from: 944725 to: 944781 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 2 from: 4258127 to: 4258183 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 3 from: 938918 to: 938974 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 769134 to: 769193 | |||
| gi-nr: gi|699111 gi_def: Mycobacterium leprae cosmid B1756 hsp_num: 1 from: 22206 to: 22262 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091738 to: 1091791 | |||
| gi-nr: gi|145362659 gi_def: Arabidopsis thaliana DEGP8 (DEGP PROTEASE 8); serine-type peptidase/ trypsin (DEGP8) mRNA, complete cds hsp_num: 1 from: 957 to: 1016 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 3 from: 1071559 to: 1071612 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 1054235 to: 1054294 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 566585 to: 566644 | |||
| gi-nr: gi|154152641 gi_def: Fervidobacterium nodosum Rt17-B1, complete genome hsp_num: 1 from: 1103306 to: 1103368 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 1 from: 4965950 to: 4966009 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 2 from: 5178264 to: 5178323 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1370796 to: 1370852 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1368340 to: 1368396 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1396752 to: 1396808 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5011660 to: 5011716 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1366518 to: 1366574 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 4 from: 5412814 to: 5412873 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 333243 to: 333299 | |||
| gi-nr: gi|31617962 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 5/14 hsp_num: 1 from: 53674 to: 53730 | |||
| gi-nr: gi|24427855 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 16/29 hsp_num: 1 from: 43612 to: 43671 | |||
| gi-nr: gi|13092922 gi_def: Mycobacterium leprae strain TN complete genome; segment 4/10 hsp_num: 1 from: 241942 to: 241998 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 241283 to: 241342 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 2 from: 1583672 to: 1583731 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 2873145 to: 2873201 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 2 from: 426994 to: 427047 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 526 to: 579 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1039 to: 1092 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696340 to: 696399 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 1 from: 1123 to: 1176 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754517 to: 754576 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 988 to: 1041 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1084 to: 1137 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725853 to: 1725912 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 926924 to: 926983 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 718 to: 771 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 998 to: 1051 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 2 from: 338250 to: 338312 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_056|beg|1114|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| taaagatttaatttcagaaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTtctctcttttatttctccagattttaacatct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt | |||
| Protein-Sequence | |||
| QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222 | |||
Coding-DNA |
|||
| aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt | |||
| Protein-Sequence | |||
| QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_057|beg|769|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaatttatttacctgatgcTagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagcttaacaccaatataTtcttctttggttttgattatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_058|beg|2464|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| taccTaaaaaatttaaagaattcactgtcaggtgataaaattTaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_059|beg|2772|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ctataaattTgcatcactgtttgcttgtggaaggtccgctcttttaattTctaacatcTtactattttaattccaaaactttcagcttcagtattacaccttcttgtattaaagccatttgtttagttctgtcttttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_061|beg|1861|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttgaataacatgattgttagtgattacaattccactctcttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga | |||
| Protein-Sequence | |||
| DQHQQPSLYILYHHQLELKYLLHF*I | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga | |||
| Protein-Sequence | |||
| DQHQQPSLYILYHHQLELKYLLHF*I | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_062|beg|2286|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| actgcaaaaattaacccaccacttcttaattgtTgaatcttttatcatctccattttttttaacaTtactttttcatttttgatggaaataaggcatataaaattccttctataaaaagaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_064|beg|755|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgcttgtccattattaatctagcttaacaccaatatatcttctttggttttgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt | |||
| Protein-Sequence | |||
| TSRSKIILISGPTASGKSNFAVKIA | |||
| Hit-Information Section | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167 | |||
| gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855 | |||
Coding-DNA |
|||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt | |||
| Protein-Sequence | |||
| TSRSKIILISGPTASGKSNFAVKIA | |||
| Hit-Information Section | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167 | |||
| gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_065|beg|722|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| gtcggcattgatgattttccttcaatttttttgcaatcttaacagcaaaatttgatttaacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_066|beg|683|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaaatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa | |||
| Protein-Sequence | |||
| ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA | |||
| Hit-Information Section | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766 | |||
Coding-DNA |
|||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa | |||
| Protein-Sequence | |||
| ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA | |||
| Hit-Information Section | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_069|beg|2328|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| atcatctccattttttttaacatacttttcatttttgatggaaataaggcatataaaattccttctataaaaaagaaaaagtccaaaagctataattagctctttcattttttagattaattttggt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_071|beg|2837|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| aattccaaaactttcacttcagtaTtttacTaccttcttgtatttaaagccatttgtttagttctgtcttttgaaagtaaagtttgtaattcttgctgacctagtacatttctcagtcttg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_072|beg|154|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttaacttcagaaatggctccattaTtttagcatgctagaagttcttaaattaattttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_073|beg|167|length|138|forward|gi | ||
| Query_DNA-Sequence | |||
| aatggctccattatttagcatgctagaagttcttaaattaattttttcaacaaTgcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaatcataca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_074|beg|1887|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| tatattctttatcaccatcaactcgaactaaaatatcttcTtgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttccttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttcct | |||
| Protein-Sequence | |||
| RKSAALGSGFIIEESGNCNH*Q | |||
| Hit-Information Section | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835395 to: 1835442 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563083 to: 1563130 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165333 to: 7165380 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_076|beg|1506|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| gatttacaactctttttgcatcgttcgatggTtattgaaaaacctatccccTatagagccacctttacccaaaattgctgtgttaattccaattacatcaccattatatcaaataaaggt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_077|beg|74|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| atttagatactgtgtcaattcggcaatTcccaattaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatTggctccattatttagcatg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_078|beg|1251|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| ctacagttttaccaacttctgtttgtgcaacaattattggtaattctttcatcttttaatcttagtgttattaaaTctctaataTtTaatgtctcctgctttaattccgctttgtcagatgggctattt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_081|beg|2109|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| tcgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaatgaagtggtgcgtctttttgcaaacccttTgtgatgcaaactttattgTcaaaaaaataataaataattttttaat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaat | |||
| Protein-Sequence | |||
| FICGSGRKINAICCKLLQR | |||
| Hit-Information Section | |||
| gi-nr: gi|18997370 gi_def: Homo sapiens chromosome 1 clone RP3-445O10, complete sequence hsp_num: 2 from: 136366 to: 136413 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_086|beg|119|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| actctgatcttttttaattttttagtttaagaaaattttttaactttcagaaaatgggctccattatttagcatgcTtagaagttcttaaattaattttttcaacaagctttctctttttgtatcaatatgtagtt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_088|beg|917|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaacagtgcctacaatatcttcaagatctttagtagattttattttttttcttttgagcttcaacaataaacatctccaacatttaagtaatctTattgggctat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt | |||
| Protein-Sequence | |||
| NSAYNIFKIFSRFYFFS | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt | |||
| Protein-Sequence | |||
| NSAYNIFKIFSRFYFFS | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_091|beg|551|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttttttgaatattttcaatttttttaattgttagttctaaccattgtcccTattgaaaatttttcattttaaatcaacaaaTtTccatTataaatgatgtttaatatttttttgtt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_092|beg|2471|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| aaatttaaagaattcactgtcaggtgataaaattaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcctctgtagaaagcaaaaaattTctgcatctcttccaaaggcttctgcaaagatc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_094|beg|1072|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgctcaaatatcttcatcattTcaatggtcttacaattatttttaaagatttaatttcagTaaatttcaTggtgtttcttctttagtttcttttttttctacttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_095|beg|2392|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| ctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattttttaggttttatgttaccaaaaaaatttaaagaattcTaTcttcaggtTgataaaaattaaagatgtctgtccac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_096|beg|169|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| tggctccattatttagcatgctagaagttcttTaaattaattttttcaacaagcttttctcttttgtatcaatatgtagttttaaaaagtcactatcattaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_097|beg|1751|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggTtataaatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgcttta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact | |||
| Protein-Sequence | |||
| PVKFGNSDQARIGDWVIAIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545 | |||
Coding-DNA |
|||
| aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct | |||
| Protein-Sequence | |||
| KATVVGADPLSDIAVLQIDSKKNL | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561 | |||
| gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515 | |||
| gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
Coding-DNA |
|||
| tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact | |||
| Protein-Sequence | |||
| PVKFGNSDQARIGDWVIAIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545 | |||
Coding-DNA |
|||
| aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct | |||
| Protein-Sequence | |||
| KATVVGADPLSDIAVLQIDSKKNL | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561 | |||
| gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515 | |||
| gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_099|beg|1365|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| cagatTgggTctattttctgcaacactagcaactaatgctcctctaggttcatctaatttttcaacttcagcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaaTttctatcaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_104|beg|2272|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| ttataaaacctataactgcaaaaattaacccaccacttcttaattgtgTaatcttttatcatctccattttttttaacatacttttcatttttgatggaaataaggcTatataaaattccttctataaaaagaaaaagtcca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgTaatcttttatcatctccattttttttaacatacttttcatttttg | |||
| Protein-Sequence | |||
| LCNLLSSPFFLTYFSFL | |||
| Hit-Information Section | |||
| gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175 | |||
Coding-DNA |
|||
| gtgTaatcttttatcatctccattttttttaacatacttttcatttttg | |||
| Protein-Sequence | |||
| LCNLLSSPFFLTYFSFL | |||
| Hit-Information Section | |||
| gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_107|beg|306|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| gatatatttgtataagaTtttaatcTtcataagctcttatggTatctttgagTtaTtcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtccttctttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_108|beg|846|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| taacTaccaatatatcttctttggttttgaTttattgtaaattacaatTcaaaaTtagttttttgattagattttaaaacagtgcctacaaTtatcttcaagatcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_110|beg|1087|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| atcattcaatggtcttacaattatttttaaagatttaatttcagaaatttaggtgTtttcttctttagtttcttttttttctacTtttaaatcctctgaagttttcaagtcttcctagtttaattttttttgta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_113|beg|1503|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| attatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattccaattacatcaccattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca | |||
| Protein-Sequence | |||
| LELTQQFWVKVASIGIGFSIPSNDAKRVVNN | |||
| Hit-Information Section | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746 | |||
| gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 2909695 to: 2909745 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427 | |||
| gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357 | |||
| gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545 | |||
Coding-DNA |
|||
| ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca | |||
| Protein-Sequence | |||
| LELTQQFWVKVASIGIGFSIPSNDAKRVVNN | |||
| Hit-Information Section | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746 | |||
| gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 2909695 to: 2909745 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427 | |||
| gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357 | |||
| gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_117|beg|1566|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| ctttacccaaaattctgtgttaattccaattacatcaccattcatatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataaccgagaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa | |||
| Protein-Sequence | |||
| VMKITFKHMHQINSGNSGGPLFEYE | |||
| Hit-Information Section | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389153 to: 1389185 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367241 to: 1367273 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354716 to: 1354748 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575 | |||
| gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167 | |||
| gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586 | |||
| gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097 | |||
| gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637 | |||
| gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773 | |||
| gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675 | |||
| gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774 | |||
| gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219 | |||
| gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782 | |||
| gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612 | |||
| gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666 | |||
| gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830 | |||
| gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212 | |||
| gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893 | |||
| gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122 | |||
| gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663 | |||
| gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539 | |||
| gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156 | |||
| gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590 | |||
| gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394 | |||
| gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490 | |||
| gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957 | |||
| gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398 | |||
| gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514 | |||
| gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631 | |||
| gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945 | |||
| gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648 | |||
| gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734 | |||
| gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587 | |||
| gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265 | |||
| gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290 | |||
| gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151 | |||
| gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582 | |||
| gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122 | |||
| gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879 | |||
| gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899 | |||
| gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071 | |||
| gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905 | |||
| gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035 | |||
| gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891 | |||
| gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995 | |||
| gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008 | |||
| gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034 | |||
Coding-DNA |
|||
| atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa | |||
| Protein-Sequence | |||
| VMKITFKHMHQINSGNSGGPLFEYE | |||
| Hit-Information Section | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389153 to: 1389185 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367241 to: 1367273 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354716 to: 1354748 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575 | |||
| gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167 | |||
| gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586 | |||
| gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097 | |||
| gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637 | |||
| gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773 | |||
| gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675 | |||
| gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774 | |||
| gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219 | |||
| gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782 | |||
| gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612 | |||
| gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666 | |||
| gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830 | |||
| gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212 | |||
| gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893 | |||
| gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122 | |||
| gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663 | |||
| gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539 | |||
| gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156 | |||
| gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590 | |||
| gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394 | |||
| gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490 | |||
| gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957 | |||
| gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398 | |||
| gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514 | |||
| gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631 | |||
| gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945 | |||
| gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648 | |||
| gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734 | |||
| gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587 | |||
| gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265 | |||
| gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290 | |||
| gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151 | |||
| gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582 | |||
| gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122 | |||
| gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879 | |||
| gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899 | |||
| gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071 | |||
| gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905 | |||
| gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035 | |||
| gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891 | |||
| gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995 | |||
| gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008 | |||
| gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_119|beg|2677|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| caTtctttgtctgcagTttgTaagtaattgtaaccgccatctctTgcacctcttgctctaaattcttttgcttctctttccctttcagtctgcattcttctataaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_120|beg|1135|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaggtgtttTcttctttagtttctttttttttctactttaaaatcctctgaagtttcaagtcTttcctagtttaattttttttgtaatctctcttttatttctccagatttaacatctacagttttaccaact | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_121|beg|2188|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| cccttgtgatgcaaaacttattgcaaaaaatataataaataatttttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccTacttcttaattgtgaatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_122|beg|2648|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| tttattagcTatttgctaaaattaagaaacatctttgtctgcagttgaagtaattgtaaccgccatctctgcTacctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctataaattgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat | |||
| Protein-Sequence | |||
| MLPLALNSFASLSFQVCILL*I | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat | |||
| Protein-Sequence | |||
| MLPLALNSFASLSFQVCILL*I | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_124|beg|1867|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| agcaccaacaaccgtcTgctttatattctttatcaccatTcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtTgattacaattccactctcttctattataaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_125|beg|399|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaagttttttataaaattttttttgtccttTctttttaacattagtctaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatataga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_127|beg|429|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| tcttttttagacattagtctaactttattttctaaacttaagaggtatTctctggaaTttttaactagtccattgattaatgattgaaaatataacctgttccaccaactaaaattgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_129|beg|649|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttaaatttttttgttcttgcttgttgggtcttgcagttaatattttttaatttttgtaaaacctgcatacttcggcattgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_130|beg|412|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| aaattttttttcccttcttttttagacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatTattgaaaatatagacctgttccaccaactaaaattggaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt | |||
| Protein-Sequence | |||
| LINGLVKIPEIPLKFRNKVKTNV*K | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949 | |||
| gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247 | |||
| gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590 | |||
Coding-DNA |
|||
| gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt | |||
| Protein-Sequence | |||
| LINGLVKIPEIPLKFRNKVKTNV*K | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949 | |||
| gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247 | |||
| gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_131|beg|1189|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaagtcttcctagtttaatttttttttgtaatctctcttttatttcccagattttaacatctacagttttaccaacttctgttttgtgcaacaattattggtaattc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_134|beg|2655|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| gcatttgctaaaaattacagaaacatctttgtctgcattgaagtaattgtaaccgccatctctgcacctcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgcatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca | |||
| Protein-Sequence | |||
| TSCSKILLLLFPFQSAFFYKLH | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca | |||
| Protein-Sequence | |||
| TSCSKILLLLFPFQSAFFYKLH | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_135|beg|1571|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| cccaaaattgctgtgttaattccaattTacatcaccattcatatcaaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga | |||
| Protein-Sequence | |||
| SIGLSRYEDYIQTDASINSGNQADLYLI | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038184 to: 1038243 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 2205020 to: 2205067 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777178 to: 777240 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2466995 to: 2467057 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887248 to: 1887292 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367268 to: 1367312 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364418 to: 1364462 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355875 to: 1355919 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349173 to: 1349217 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1177848 to: 1177910 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 446564 to: 446626 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1158669 to: 1158731 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1157008 to: 1157070 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1277786 to: 1277848 | |||
| gi-nr: gi|2077988 gi_def: C.jejuni htrA gene hsp_num: 1 from: 657 to: 719 | |||
| gi-nr: gi|881374 gi_def: Campylobacter jejuni heat shock protein/serine protease (htrA) and OmpR protein (ompR) genes, partial cds hsp_num: 1 from: 300 to: 362 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8664 to: 8708 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 821479 to: 821538 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418555 to: 2418599 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617821 to: 2617865 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175321 to: 5175380 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535290 to: 2535349 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455153 to: 2455212 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835722 to: 1835769 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 682 to: 720 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 490 to: 528 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 952 to: 990 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1048 to: 1086 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 962 to: 1000 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1003 to: 1041 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325713 to: 325757 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316824 to: 2316868 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904655 to: 904699 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118083 to: 2118127 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057417 to: 2057461 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395879 to: 1395923 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085596 to: 2085640 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 29111 to: 29155 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563416 to: 1563460 | |||
| gi-nr: gi|1184674 gi_def: Pseudomonas aeruginosa HtrA-like serine protease AlgW gene, complete cds hsp_num: 1 from: 647 to: 691 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_136|beg|1888|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| atattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaataacatgattgttTagtgattacaattccactctcttctattataaatcctgaaccaagtgca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaata | |||
| Protein-Sequence | |||
| ILYHHQLETKNLLHFE*H | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_137|beg|1463|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| acacccagccatcctttttagtttcaccaaattctatcaattgatttacaaactctttttcatcgttcgatggtattgaaaaaccTtatcccaatagagccacctttacccaaaatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_139|beg|1739|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aagccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtataaatttttcttttgaatctatttgaagggactgcaatatcagataaagg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat | |||
| Protein-Sequence | |||
| FIPVKFGNSDQARIGDWVIAIGQSLWL | |||
| Hit-Information Section | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009 | |||
Coding-DNA |
|||
| agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat | |||
| Protein-Sequence | |||
| FIPVKFGNSDQARIGDWVIAIGQSLWL | |||
| Hit-Information Section | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_141|beg|506|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| tgattgaaaataTtagacctgttccaccaactaaaattggaatttttttctttttttgaatattttcaattttttttaattgttagttctaaccattgtccagTttgaaatttttcatttaaatcaacTa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_143|beg|976|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaacaataacatctccaacatttaagtaatctattTgggctattttttccaatatttgttataactaaaccgttgtttgattgggtaattttctttgctcaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_144|beg|430|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| cttttttagacattagtctaactttatttctaaacttTaagaggtatctctggaattttaactagccattgattaatgattgaaatatagacctgttcccaccaactaaaattggaatttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_146|beg|2552|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| tcTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacccttcatgatttcagattctttattagcatttgctaaaattacagaaaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacc | |||
| Protein-Sequence | |||
| RVKVNGERNKIFAEAFGRDAEFFAFYK | |||
| Hit-Information Section | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417151 to: 2417219 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610391 to: 3610459 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2119180 to: 2119254 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086693 to: 2086767 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_147|beg|2563|length|138|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaaaattctgcTatctcttccaaaggctttctgcTaaagatcttatttctttcaccatcaccttgacccttTcatgatttcagattctttattagcatttgctaaattacagaaacaTtctttgtcTtgcagttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_148|beg|1090|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| attcaatgtcttacaattatttttaaagatttaatttcagaaatttcaggtgTtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgaatctc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_150|beg|845|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaacaccaatatatcttctttggtttttgattattgtaaattacaatcaaaatagttttttgatttagattttaaaacagttgcctacaatatcttcaagatctttagtagattttattttttttcttttTgagcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_151|beg|2095|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtcttttgcaaacccttgtgatgcaaaact | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt | |||
| Protein-Sequence | |||
| QKNAPASFADLAEKLMPSVVNISTNDNSYY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
Coding-DNA |
|||
| gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt | |||
| Protein-Sequence | |||
| QKNAPASFADLAEKLMPSVVNISTNDNSYY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_157|beg|812|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| aattttggactgcttgtccattattaaTtctagcttaacaccaaatatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgaTttagattttaaaacagtgccctacaataTtcttcaagatcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_159|beg|2326|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| ttatcatctccattttttaacatacttttcatttttgatggaaataaggcatataaattcctttataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_160|beg|726|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| gcattgatgatttctccttcaattttttttgcaatcttTaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagctaacaTccaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_161|beg|2351|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| acttttcatttttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattgctctttcattattttTagattaattttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_168|beg|456|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatatagacTtgttccaccaactaaaattggaatttttttTctttttttgaatattttcaatttttttaattg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_171|beg|2344|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaacatacttttcattttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaatttttaggttttatgttaccaaaaaaatttaaagaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_172|beg|2130|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| cagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaataattttttaattctgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaa | |||
| Protein-Sequence | |||
| DGINFSARSANEAGASFANPCDAKLIAKNIIK | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6132 to: 6233 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_173|beg|2099|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| gtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaactt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVKHFYNDNSY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153 | |||
Coding-DNA |
|||
| taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVKHFYNDNSY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_174|beg|118|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| cactctgatcttttttaatttttagtttaagaaattttttaacttcTagaaatggctccattattttagcatgctagaaTttcttaaattaatttttcaacaacttttctctttttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_176|beg|703|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat | |||
| Protein-Sequence | |||
| ILISGPTASGKSNFALRLQKKLKGEIINADSMQVYK | |||
| Hit-Information Section | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2665684 to: 2665791 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 447944 to: 448048 | |||
| gi-nr: gi|145361991 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|145358247 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|14532863 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 157 to: 264 | |||
| gi-nr: gi|13430591 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 272 to: 379 | |||
| gi-nr: gi|21404588 gi_def: Arabidopsis thaliana clone 19250 mRNA, complete sequence hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|14279069 gi_def: Arabidopsis thaliana AtIPT9 mRNA for tRNA isopentenyltransferase, complete cds hsp_num: 1 from: 157 to: 264 | |||
| gi-nr: gi|147865869 gi_def: Vitis vinifera contig VV78X183130.5, whole genome shotgun sequence hsp_num: 1 from: 17496 to: 17597 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_178|beg|798|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| cctgTaaattaagataattttggactgcttgtccattattaatctagcttaacTaccaatatatcttctttggTtttttgattattgtaaattacaatcaaaatagttttttgatagatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_180|beg|1876|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| aaccgtcgctttatattctttatcaccTatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcaTgcagacttccttgtt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca | |||
| Protein-Sequence | |||
| MEIVITNNHVIQNAEDILVRVDR | |||
| Hit-Information Section | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510 | |||
| gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586 | |||
Coding-DNA |
|||
| Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca | |||
| Protein-Sequence | |||
| MEIVITNNHVIQNAEDILVRVDR | |||
| Hit-Information Section | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510 | |||
| gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_184|beg|2553|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcaccatcaccttgacccttcatgatttcagattctttaTttagcatttgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca | |||
| Protein-Sequence | |||
| CRKQKILHLFQRLLQMILFLSP | |||
| Hit-Information Section | |||
| gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879 | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317 | |||
| gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216 | |||
| gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555 | |||
| gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692 | |||
| gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175 | |||
| gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353 | |||
| gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857 | |||
| gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104 | |||
Coding-DNA |
|||
| tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca | |||
| Protein-Sequence | |||
| CRKQKILHLFQRLLQMILFLSP | |||
| Hit-Information Section | |||
| gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879 | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317 | |||
| gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216 | |||
| gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555 | |||
| gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692 | |||
| gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175 | |||
| gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353 | |||
| gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857 | |||
| gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_186|beg|1013|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| gggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaaagatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_187|beg|162|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| tcagaaaTtggctccattatttagcatgctagaagttcttaaattaatttttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_188|beg|62|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| ggtaatttcatcatttagatactgtgtcaattcggcaatcccaattaccTttTgtttacactctgatcttttttaatttttagtttTaagaaattttttaactt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_191|beg|1166|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| tctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaatctctcttttatttctccagattttaacatctacagtttttaccaacttctgtttgtgcaacaattattggtaattct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_192|beg|2154|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gatccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattgcaaaaaatataataaataattttttaaattctgttctttaactttttatataccaaataattataaaacctataactgca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg | |||
| Protein-Sequence | |||
| CNKFCITKGFAKRRTTSFAD | |||
| Hit-Information Section | |||
| gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703 | |||
| gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660 | |||
Coding-DNA |
|||
| atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg | |||
| Protein-Sequence | |||
| CNKFCITKGFAKRRTTSFAD | |||
| Hit-Information Section | |||
| gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703 | |||
| gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_193|beg|2191|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaTtaactgTcaaaaattaacccaccacttcttaatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT | |||
| Protein-Sequence | |||
| VMQNLIAKNIINNFLIRHFNFLLPNNYKTY | |||
| Hit-Information Section | |||
| gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081 | |||
Coding-DNA |
|||
| tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT | |||
| Protein-Sequence | |||
| VMQNLIAKNIINNFLIRHFNFLLPNNYKTY | |||
| Hit-Information Section | |||
| gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_196|beg|644|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| atgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacac | |||
| Protein-Sequence | |||
| LIFFCSCLLGLAVNIFNFFVNLSYCLALMISPSIFFAILT | |||
| Hit-Information Section | |||
| gi-nr: gi|18250105 gi_def: Homo sapiens BAC clone RP11-9N12 from 4, complete sequence hsp_num: 2 from: 89832 to: 89855 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_197|beg|1777|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| aattcttgcTttgatcagaatttccaaatttaaTctggtataaatttttcttttgaatTctatttgaaggactgcaatatcaataagggatcTagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_198|beg|2133|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| atggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaacttttttatata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt | |||
| Protein-Sequence | |||
| AKDAPASFADLAEKLMP | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166 | |||
Coding-DNA |
|||
| tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt | |||
| Protein-Sequence | |||
| AKDAPASFADLAEKLMP | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_201|beg|1222|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| ctctcttttatttctccagaTttttaacaTtctaTcagttttaccaacttctgtttgtgcTaacaattTattggtaattctttcatctctttaatcttagtgtta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_206|beg|1287|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaacactagcaactaatgctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa | |||
| Protein-Sequence | |||
| CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP | |||
| Hit-Information Section | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279 | |||
Coding-DNA |
|||
| tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa | |||
| Protein-Sequence | |||
| CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP | |||
| Hit-Information Section | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_207|beg|706|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtaaacctgcatactgtcggcttgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttacctgtgcagtcggtcctgaaattaag | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_208|beg|2200|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaacttattgcaaaaaatataataaataattttttaattctgttcattttTaacttttttatataccaaataattataaaacctataactgcaaaaattaacccacccacttcttaattgtgaatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_211|beg|947|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| ttagtagattttattttttttcttttgagcttTcaacaataacatctccaacatttaagtaatctattgggctattttttccaatatttgttaTtaactaaacct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_213|beg|491|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| tagtccattgattaatgattgaaaatatagacctgttccaccaactaaaattggaatttttttttctttttttgaaattattttcaatttttttaattgttagttctaaccattgtccagttgaaaatttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_214|beg|1317|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgcaactaatctcctctaggtcatctaatttttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc | |||
| Protein-Sequence | |||
| LHSVAENSPSDKAGIKAGDIILEFNN | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528 | |||
Coding-DNA |
|||
| gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc | |||
| Protein-Sequence | |||
| LHSVAENSPSDKAGIKAGDIILEFNN | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_215|beg|889|length|99|forward|gi | ||
| Query_DNA-Sequence | |||
| aatcaaaatagtttttgattagatttttaaaacagtgcctacaatatcttcaaatctttagtagattttatttttttctttgagcttcaacaataacat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_216|beg|369|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| aatttgtcttttgaTttttaggatcaagttttaaaagttttttataaaattttttttgtccttctttttttagacattaTgtctaactttatttctaaacttaagaggtatctctgga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_217|beg|1018|length|100|forward|gi | ||
| Query_DNA-Sequence | |||
| attttttccaatatttgttTataactaaacctgttgtttgattgggtaattttttgctcaatatcttcatcattcaatgggtcttacaattatttttaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_218|beg|2103|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| tgttgtcgttgtagaaatgttacaacagatggTcattaattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaataatttttt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata | |||
| Protein-Sequence | |||
| IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN** | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233 | |||
| gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525 | |||
Coding-DNA |
|||
| taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata | |||
| Protein-Sequence | |||
| IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN** | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233 | |||
| gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_220|beg|938|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| tcaagatctttagtagattttatttttttcttttggcttcaacaataacatctccaacatttaaagtaattctattgggctattttttccaatattgttataactaaaccc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_224|beg|149|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| aaattttttaacttcagaaaTtggctccattatttagcatgctagaagttcttaaattaattttttcaacaagTcttttctctttttgtTatcaatatggtagttttTaaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_229|beg|1420|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| tttttcaacttcacaatttcttcagaaacttacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaacctatcccaatag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa | |||
| Protein-Sequence | |||
| VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920 | |||
Coding-DNA |
|||
| aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa | |||
| Protein-Sequence | |||
| VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_232|beg|456|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaaatttttaactagtccattgattaatgattgaaaatatTagacctgttccaccaactaaaattggaattttttttcttttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_233|beg|1242|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttaacatctacaTgttttaccaacttctgtttgtgcaacaattattggtaattctttcatctTctttaatcttagtgtttattaaactctaatataatgtctcctgcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_234|beg|2186|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| aacccttgtgatgcaaaacttattgcaaaaaataTtaataaatTaattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_235|beg|1926|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcattttgaataacttgattgttagtgattacaattccactctcttctattataaatccTtgTaaccaagtgcagcagaTcttccttgtttgaggtgttccaaattctttTgaacatatcttcaaaaggtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat | |||
| Protein-Sequence | |||
| GFIIEESGIVITNNQVIQNA | |||
| Hit-Information Section | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370 | |||
Coding-DNA |
|||
| tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat | |||
| Protein-Sequence | |||
| GFIIEESGIVITNNQVIQNA | |||
| Hit-Information Section | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_236|beg|39|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| attaactcttctgcttcatccaaggtaatttcatcatttagatactgtgtcaattcggcaatcccaatttaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatggctccat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_238|beg|298|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| catacatagatatattgtataagatttaatctcataagctcttatggatctttgagtTatcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_239|beg|1785|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| cttgatcagaatttccaaaatttaactggtataaatttttcttttgaatctatttgaaggactgcaatatagataagggatcagcaTccaacaaccgtcgcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_240|beg|2650|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tattagcatttgctaaaattacagaaacTatctttgtctgcagttgaagtaattgtaaccgccatctctgcacctttgctctaaattcttttgcTttctctttccctttcagtctgcattct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_242|beg|2685|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tctgcagttgaagtaattgtaaccgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcctgcattcttctataaattgcatcTactgTtttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc | |||
| Protein-Sequence | |||
| NRHLCTSCLNSLLLFPFQS | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728 | |||
| gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836 | |||
| gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331 | |||
Coding-DNA |
|||
| accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc | |||
| Protein-Sequence | |||
| NRHLCTSCLNSLLLFPFQS | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728 | |||
| gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836 | |||
| gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_243|beg|2274|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| aTtaaaacctataactgcaaaaattaacccaccacttcttaattgtgaatcttttatcatctccatttttttaacatacttttcattttgatggaaataaggcatataaaattccttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_244|beg|2261|length|100|forward|gi | ||
| Query_DNA-Sequence | |||
| ataccaaaTtaattataaaacctataacTtgcaaaattaacccaccacttTcttaattgtgaatcttttatcatctccattttttaacatacttttcatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_245|beg|865|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggttttgattatttgtaaattTacaatcaaaatagttttttgattagattttaaaacagtgcctacaatatcttcaagatctttagtagattttatttttttcttttgagcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_247|beg|40|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaactcttctgcttcatccaaggtaatttcaTtcatttagatactgtTtcaattcggcaatcccaattaccttgtttacactctgatTctttttttaatttttaTgtttaagaaattttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_248|beg|2769|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| cttctataaattgcatcactgttttgcttgtggaaggtccgctcttttaatttctaacatctTactattttaattccaaaactttcagcttcagtatttacaccttcttgTtattaaagccatttgtttag | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | rreeaadd_249|beg|2033|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaacatacttTcaaaaggtgatcctgggggaaactgaaaaccaggaaatggattagaatttgtagtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccTagatccgca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_001|beg|888|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggT | |||
| Protein-Sequence | |||
| GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWVWY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613 | |||
| gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340 | |||
Coding-DNA |
|||
| tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggT | |||
| Protein-Sequence | |||
| GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWVWY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613 | |||
| gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_002|beg|758|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Coding-DNA |
|||
| ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt | |||
| Protein-Sequence | |||
| PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_004|beg|641|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_006|beg|1414|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt | |||
| Protein-Sequence | |||
| KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF | |||
| Hit-Information Section | |||
| gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_008|beg|644|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_010|beg|533|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_011|beg|1241|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_012|beg|1105|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Coding-DNA |
|||
| gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt | |||
| Protein-Sequence | |||
| RKEFGRKFGEIQGGKLRPGDSFP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217 | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_014|beg|116|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Coding-DNA |
|||
| TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc | |||
| Protein-Sequence | |||
| RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_017|beg|1014|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_019|beg|1097|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Coding-DNA |
|||
| taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact | |||
| Protein-Sequence | |||
| LIQGGKNSGLSFPPCNLFRIFFQT | |||
| Hit-Information Section | |||
| gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_020|beg|737|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Coding-DNA |
|||
| ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt | |||
| Protein-Sequence | |||
| PLSFHSLGESTRWNFRCLRWLGF | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818 | |||
| gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096 | |||
| gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_023|beg|307|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg | |||
| Protein-Sequence | |||
| FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686 | |||
| gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_024|beg|1651|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_026|beg|1|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_027|beg|980|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_029|beg|787|length|99|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Coding-DNA |
|||
| aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga | |||
| Protein-Sequence | |||
| DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_030|beg|369|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta | |||
| Protein-Sequence | |||
| HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL | |||
| Hit-Information Section | |||
| gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520 | |||
| gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_031|beg|1449|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg | |||
| Protein-Sequence | |||
| LELVKKANLIIYSERLKRK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_032|beg|1594|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_034|beg|1680|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Coding-DNA |
|||
| cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT | |||
| Protein-Sequence | |||
| PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_035|beg|403|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga | |||
| Protein-Sequence | |||
| SSRSLNVSILVFPVTRPLSR | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 8 from: 172424 to: 172495 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_036|beg|927|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa | |||
| Protein-Sequence | |||
| LSYARICPNPPRRNVRVKDCIKEH*S | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_039|beg|348|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Coding-DNA |
|||
| ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc | |||
| Protein-Sequence | |||
| KGHGPYAVYSSVALYEKPQEMEGWLGN | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_040|beg|1698|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| caacgctaactattttggaattgcgtccataaaatcattaattgaccccgaatccttttagtagttctttagctttttcactaaatggtcagcatgatcatcactaaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_044|beg|1656|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_045|beg|1544|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_046|beg|21|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Coding-DNA |
|||
| aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa | |||
| Protein-Sequence | |||
| FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_048|beg|1471|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_050|beg|1088|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Coding-DNA |
|||
| ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga | |||
| Protein-Sequence | |||
| MEENSGRFKEGKLRPEFFPPCIKNP | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_053|beg|875|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Coding-DNA |
|||
| tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag | |||
| Protein-Sequence | |||
| ICPNPPRRNVRVKDCIKDIRVITEEILPIIN | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_055|beg|880|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Coding-DNA |
|||
| ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt | |||
| Protein-Sequence | |||
| RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_057|beg|596|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_060|beg|428|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Coding-DNA |
|||
| ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc | |||
| Protein-Sequence | |||
| REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_061|beg|941|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_067|beg|463|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa | |||
| Protein-Sequence | |||
| TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG | |||
| Hit-Information Section | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_068|beg|832|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Coding-DNA |
|||
| gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc | |||
| Protein-Sequence | |||
| PIIIEAANRCSPPLFEDQPNEIKNIW | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_069|beg|1530|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Coding-DNA |
|||
| agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc | |||
| Protein-Sequence | |||
| LSSPFSQVRVLYHRVSRIRAP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_071|beg|1193|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_074|beg|1168|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Coding-DNA |
|||
| tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc | |||
| Protein-Sequence | |||
| KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_075|beg|616|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_076|beg|257|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Coding-DNA |
|||
| ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa | |||
| Protein-Sequence | |||
| LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405 | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_077|beg|136|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca | |||
| Protein-Sequence | |||
| LQNSNMVTPSRIYDMYVI | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_079|beg|399|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Coding-DNA |
|||
| aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta | |||
| Protein-Sequence | |||
| VNAGINGIGVRGPYVNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452 | |||
| gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_080|beg|172|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat | |||
| Protein-Sequence | |||
| ILREELGFNDIHIIYSGRGYPY*S | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322 | |||
| gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_084|beg|1347|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_085|beg|335|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Coding-DNA |
|||
| ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt | |||
| Protein-Sequence | |||
| ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE | |||
| Hit-Information Section | |||
| gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_086|beg|1748|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_088|beg|1859|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_089|beg|41|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_093|beg|1523|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Coding-DNA |
|||
| aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta | |||
| Protein-Sequence | |||
| DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_094|beg|1505|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Coding-DNA |
|||
| aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT | |||
| Protein-Sequence | |||
| MPILGALSYSPYGIELELVKKANLIII | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_096|beg|1310|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_098|beg|863|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattaTttatcggtaaaatttcctcagttTattactctaatgtcctttata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt | |||
| Protein-Sequence | |||
| IIEAANRCSPPLFRGSNPMRSR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_100|beg|1440|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_101|beg|1647|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_102|beg|1434|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_103|beg|447|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_104|beg|1722|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Coding-DNA |
|||
| gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT | |||
| Protein-Sequence | |||
| SIKSLIDPNPFSSSLAFS | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_106|beg|346|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_108|beg|341|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Coding-DNA |
|||
| ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT | |||
| Protein-Sequence | |||
| SHLLNGLSPLASMSKTSSVPNHPSISWGFSL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_114|beg|1699|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_115|beg|897|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Coding-DNA |
|||
| aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag | |||
| Protein-Sequence | |||
| DCIKGLRVITEEILPIIIEAANRCSP | |||
| Hit-Information Section | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_116|beg|1617|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Coding-DNA |
|||
| atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt | |||
| Protein-Sequence | |||
| IHYVILYLKTCLSVSHF | |||
| Hit-Information Section | |||
| gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_121|beg|748|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg | |||
| Protein-Sequence | |||
| PGGISAVFEARICCIIQIRGGTRYS*S | |||
| Hit-Information Section | |||
| gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_122|beg|1722|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Coding-DNA |
|||
| Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc | |||
| Protein-Sequence | |||
| MIMLDPFSEKAKELLKGFGI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_123|beg|1128|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Coding-DNA |
|||
| ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa | |||
| Protein-Sequence | |||
| FSSLNLSEFSSKLFLRK | |||
| Hit-Information Section | |||
| gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_124|beg|1098|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_128|beg|232|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Coding-DNA |
|||
| tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat | |||
| Protein-Sequence | |||
| VCPICLNDAKEIVRDTVIILREELGFNDIHI | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_129|beg|1356|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Coding-DNA |
|||
| tctttcaattttccttacatcctctgttggaaattctatggcggtgctc | |||
| Protein-Sequence | |||
| TLSIFLTSSVGNSMAVL | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_130|beg|551|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_131|beg|98|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg | |||
| Protein-Sequence | |||
| SFLNSSTSSISLAETNDKNSFPWTSNLA*G | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT | |||
| Protein-Sequence | |||
| MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF | |||
| Hit-Information Section | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_132|beg|1398|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Coding-DNA |
|||
| ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc | |||
| Protein-Sequence | |||
| LWNFYRKLFQFSLHPLWKFLWRC | |||
| Hit-Information Section | |||
| gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667 | |||
| gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_133|beg|369|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc | |||
| Protein-Sequence | |||
| HLCQRRVQSLTHPSISWGF | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Coding-DNA |
|||
| gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta | |||
| Protein-Sequence | |||
| SATLGINGIGGLWPLCNLRDP*C | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_135|beg|1183|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP | |||
| Hit-Information Section | |||
| gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932 | |||
Coding-DNA |
|||
| tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc | |||
| Protein-Sequence | |||
| GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_137|beg|1246|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_142|beg|1222|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_143|beg|627|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Coding-DNA |
|||
| ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta | |||
| Protein-Sequence | |||
| CKYIRNPLTYYLRRLTWREEGMLLREVTREERK | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779 | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_144|beg|667|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Coding-DNA |
|||
| cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt | |||
| Protein-Sequence | |||
| IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_145|beg|787|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Coding-DNA |
|||
| atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt | |||
| Protein-Sequence | |||
| QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534 | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_148|beg|628|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct | |||
| Protein-Sequence | |||
| SFLSCYLFLGAFLLPSRYNLL | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_149|beg|1569|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_150|beg|956|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Coding-DNA |
|||
| taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta | |||
| Protein-Sequence | |||
| NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_151|beg|401|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Coding-DNA |
|||
| ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT | |||
| Protein-Sequence | |||
| PSLHFLGLLIKCNAGINWHRGPWPLL | |||
| Hit-Information Section | |||
| gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142 | |||
| gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_153|beg|598|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Coding-DNA |
|||
| gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa | |||
| Protein-Sequence | |||
| GYTWREEGMLLREVTREERKNFYT | |||
| Hit-Information Section | |||
| gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_159|beg|1496|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_161|beg|141|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Coding-DNA |
|||
| aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat | |||
| Protein-Sequence | |||
| TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV | |||
| Hit-Information Section | |||
| gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903 | |||
| gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873 | |||
| gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_165|beg|1453|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Coding-DNA |
|||
| tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca | |||
| Protein-Sequence | |||
| *SPFFFLVSLNKLIKFAFFTSS | |||
| Hit-Information Section | |||
| gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_167|beg|1547|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_001|beg|2512|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| tctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttgacc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttga | |||
| Protein-Sequence | |||
| GQGDGERNKIFAEAFGRDAEFFAFYRAMQAYETAFNWWNR | |||
| Hit-Information Section | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417142 to: 2417237 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610373 to: 3610468 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_002|beg|2211|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaaaatataataaaataattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccacttcttaatttgtgaatcTtttatcatctTccatttttttttaacat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_007|beg|268|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| taaattcagatttagtcttagctaaccaatcatacatagatatattgtataagatttaatctcataagctcttatggactttggtatcatttggatcaaatttgtct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_011|beg|1665|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt | |||
| Protein-Sequence | |||
| KQELGDWVIAIGNPFGLGGTVTAGIIQQEIDQSDCLRYKL | |||
| Hit-Information Section | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887137 to: 1887214 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 2 from: 2802806 to: 2802883 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355953 to: 1356030 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349251 to: 1349328 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8553 to: 8630 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367346 to: 1367423 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364496 to: 1364573 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 489285 to: 489362 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836329 to: 2836406 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456492 to: 3456569 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165081 to: 7165158 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785844 to: 5785915 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683226 to: 683303 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219544 to: 3219621 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322989 to: 6323066 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 3168642 to: 3168713 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946774 to: 2946851 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757259 to: 5757336 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151682 to: 2151759 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418444 to: 2418521 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250103 to: 2250180 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713911 to: 3713988 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997510 to: 1997587 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609103 to: 3609180 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3949530 to: 3949607 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168194 to: 1168262 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320873 to: 2320950 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246280 to: 246357 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 550628 to: 550705 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71227 to: 71304 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62585 to: 62662 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 848 to: 925 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 821 to: 898 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667639 to: 1667716 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 2 from: 164754 to: 164825 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432575 to: 432640 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367887 to: 6367964 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211350 to: 1211427 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 3977259 to: 3977324 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663790 to: 2663867 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 1013990 to: 1014058 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617902 to: 2617979 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552048 to: 3552125 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917630 to: 3917698 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625378 to: 1625455 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 3004488 to: 3004565 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340230 to: 1340298 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294304 to: 2294381 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266551 to: 266619 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170820 to: 170888 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497381 to: 1497449 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 3402718 to: 3402786 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991977 to: 992045 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1866553 to: 1866621 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5742 to: 5819 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966525 to: 966602 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 2002161 to: 2002229 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556193 to: 2556261 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563305 to: 1563382 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 2 from: 867750 to: 867815 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973562 to: 2973639 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302025 to: 1302102 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205095 to: 2205163 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 1038097 to: 1038165 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99410 to: 99487 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69430 to: 69507 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838175 to: 3838243 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1347106 to: 1347171 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 464956 to: 465033 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434048 to: 434119 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360580 to: 2360648 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933533 to: 1933604 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6508 to: 6576 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 1481604 to: 1481672 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472412 to: 1472477 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119358 to: 1119435 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299953 to: 300030 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 525 to: 596 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360485 to: 360556 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 812523 to: 812594 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209940 to: 1210008 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455231 to: 2455302 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193379 to: 1193447 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206735 to: 1206803 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852865 to: 852936 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707251 to: 1707316 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968960 to: 969028 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730842 to: 4730913 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 752 to: 820 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227875 to: 3227946 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192123 to: 2192200 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634431 to: 634499 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970353 to: 970424 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79057 to: 79128 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967615 to: 967686 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927065 to: 927130 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881028 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90043 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273794 to: 273865 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219050 to: 219121 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946806 to: 946877 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246511 to: 246582 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124538 to: 1124609 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120943 to: 1121014 | |||
| gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 896671 to: 896742 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576887 to: 576955 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725706 to: 1725771 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427034 to: 427102 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780576 to: 1780644 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799750 to: 2799818 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750324 to: 2750392 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837587 to: 2837655 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462275 to: 2462343 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564603 to: 564671 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210100 to: 3210168 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 501552 to: 501617 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647528 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777118 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2244783 to: 2244854 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939965 to: 2940033 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934462 to: 1934530 | |||
| gi-nr: gi|33238865 gi_def: Prochlorococcus marinus subsp. marinus str. CCMP1375 complete genome hsp_num: 1 from: 116489 to: 116560 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 1119186 to: 1119251 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3095258 to: 3095326 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696481 to: 696546 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 2 from: 754658 to: 754723 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 3267195 to: 3267266 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 559 to: 627 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978033 to: 3978101 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7924 to: 7992 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 953 to: 1021 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242058 to: 242126 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249322 to: 249390 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242049 to: 242117 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241163 to: 241231 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 335 to: 373 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829861 to: 829929 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619717 to: 3619785 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239147 to: 3239215 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913587 to: 3913655 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651877 to: 3651945 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796537 to: 796605 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903457 to: 3903525 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259710 to: 259778 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343281 to: 1343352 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428584 to: 1428649 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1933 to: 1998 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688687 to: 688752 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087596 to: 4087664 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 3457286 to: 3457351 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253502 to: 253570 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142957 to: 143022 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79450 to: 79515 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146093 to: 146158 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 1583819 to: 1583884 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252713 to: 252781 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502816 to: 2502884 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1374 to: 1442 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531144 to: 531212 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369821 to: 369889 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53608 to: 53679 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979313 to: 3979381 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350811 to: 4350879 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481613 to: 2481678 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189185 to: 4189253 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935880 to: 3935948 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149077 to: 149145 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180877 to: 4180945 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16885 to: 16953 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 100 to: 138 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264307 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264227 to: 1264265 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 514 to: 582 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767214 to: 5767279 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808372 to: 808437 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238515 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147992 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147452 to: 147490 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914076 to: 914141 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4770 to: 4808 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191807 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226813 to: 226881 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_012|beg|1640|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| gagtttattgTatgcatcagtttgaatgtaatcttTcaTtaacgagacagtTccgattgatcTtatttcttgctgatattattcctcagtaaccgttcctcctaagccaaaggggattgccgattgcgataacc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_013|beg|638|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| atataaatgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttgtaaacctgcatactgtTcggattgatgattttctccttcaatttttttttgcaatctta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_014|beg|1004|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| taatctattgggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_015|beg|776|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| tgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagTcttaacaccaatatatcTttcttggttttgattattgtaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_016|beg|2747|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc | |||
| Protein-Sequence | |||
| ESFGIKIVDVRIKRADLPQANSDAIYRRIRLKGK | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797881 to: 797970 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205782 to: 1205871 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 11010 to: 11093 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011138 to: 1011221 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353700 to: 1353789 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080087 to: 1080176 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 582399 to: 582482 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2619018 to: 2619065 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_017|beg|456|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaatttttaactagTtccattgattaatgattgaaaatatagacctgttccaccTaactaaaattggaattttttttctttttttTgaatat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_018|beg|2521|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| caaTttaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaatttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTcaccttgacccTttcatg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc | |||
| Protein-Sequence | |||
| NLHLFQRLLQKILFLSPF | |||
| Hit-Information Section | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107 | |||
Coding-DNA |
|||
| ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc | |||
| Protein-Sequence | |||
| MHRSVESKKFASLPKASAKDLISFTIH | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_020|beg|1843|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| gactgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgattaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| actgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgatt | |||
| Protein-Sequence | |||
| LQYQDKGSAPTTVALYSLSPSTRTKISSAFCNNMIVSD* | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_024|beg|2741|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaacatctactattttaattccaaaactttcagct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca | |||
| Protein-Sequence | |||
| MLELKEADLPQSNSDAIYRRMQTEREREA | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197 | |||
| gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77 | |||
Coding-DNA |
|||
| tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca | |||
| Protein-Sequence | |||
| MLELKEADLPQSNSDAIYRRMQTEREREA | |||
| Hit-Information Section | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197 | |||
| gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_025|beg|2094|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacTttattgcaaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISTTTTVTT | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Coding-DNA |
|||
| tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISTTTTVTT | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_026|beg|2198|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaactttttatataccaataattataaaaaccTtataactgcaaaaattaacccaccacttcttaattgtgaatcttttaTtcTatc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_027|beg|1217|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| gtaatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatttttcatctctttaatcttagtgttattaaactcta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatt | |||
| Protein-Sequence | |||
| NLSFISPDFNIYYVLPTSVCATIIGKF | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_028|beg|32|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| aattgatattaactTcttctgcttTcatccaaggtaaTtttcatcaTtttagatTactgtgtcaattcggcaatcccaaTttaccttgtttacactctgatTcttttttaatttttagtttaagaaattttttaact | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_029|beg|2108|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gtcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgaaaacttattgcaaaaaatataata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISKR | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Coding-DNA |
|||
| tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVNISKR | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_030|beg|1689|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| cgattgatctatttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataacccaatcaccaattcttgcttgatcTagaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc | |||
| Protein-Sequence | |||
| LGYAIGNPFGLGGTVTAGIISKK*I | |||
| Hit-Information Section | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2663817 to: 2663870 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 4 from: 2961597 to: 2961650 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792 | |||
| gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209 | |||
| gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529 | |||
| gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973 | |||
| gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925 | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606 | |||
| gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656 | |||
| gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325 | |||
| gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172 | |||
| gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648 | |||
| gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573 | |||
| gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784 | |||
| gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285 | |||
| gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779 | |||
| gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658 | |||
| gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455 | |||
| gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695 | |||
| gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634 | |||
| gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686 | |||
| gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616 | |||
| gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670 | |||
| gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876 | |||
| gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886 | |||
| gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378 | |||
| gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585 | |||
| gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586 | |||
| gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726 | |||
| gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581 | |||
| gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227 | |||
| gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696 | |||
| gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959 | |||
| gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755 | |||
| gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415 | |||
| gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669 | |||
| gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666 | |||
| gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195 | |||
| gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595 | |||
| gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162 | |||
| gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389 | |||
| gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876 | |||
| gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411 | |||
| gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034 | |||
| gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890 | |||
| gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780 | |||
| gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440 | |||
| gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515 | |||
| gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335 | |||
| gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251 | |||
| gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519 | |||
| gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488 | |||
| gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448 | |||
| gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602 | |||
| gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869 | |||
| gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423 | |||
| gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002 | |||
| gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779 | |||
| gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739 | |||
| gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130 | |||
| gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368 | |||
| gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769 | |||
Coding-DNA |
|||
| tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc | |||
| Protein-Sequence | |||
| LGYAIGNPFGLGGTVTAGIISKK*I | |||
| Hit-Information Section | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2663817 to: 2663870 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 4 from: 2961597 to: 2961650 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371 | |||
| gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366 | |||
| gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635 | |||
| gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934 | |||
| gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923 | |||
| gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792 | |||
| gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209 | |||
| gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529 | |||
| gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973 | |||
| gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925 | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606 | |||
| gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315 | |||
| gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656 | |||
| gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325 | |||
| gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172 | |||
| gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648 | |||
| gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573 | |||
| gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784 | |||
| gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285 | |||
| gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603 | |||
| gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779 | |||
| gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658 | |||
| gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455 | |||
| gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695 | |||
| gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634 | |||
| gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686 | |||
| gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616 | |||
| gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670 | |||
| gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876 | |||
| gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886 | |||
| gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378 | |||
| gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585 | |||
| gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586 | |||
| gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726 | |||
| gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581 | |||
| gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227 | |||
| gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696 | |||
| gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959 | |||
| gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755 | |||
| gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415 | |||
| gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669 | |||
| gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666 | |||
| gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195 | |||
| gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595 | |||
| gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162 | |||
| gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389 | |||
| gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920 | |||
| gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121 | |||
| gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007 | |||
| gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500 | |||
| gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876 | |||
| gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411 | |||
| gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294 | |||
| gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034 | |||
| gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890 | |||
| gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780 | |||
| gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440 | |||
| gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515 | |||
| gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335 | |||
| gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251 | |||
| gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519 | |||
| gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488 | |||
| gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448 | |||
| gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602 | |||
| gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869 | |||
| gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423 | |||
| gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002 | |||
| gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779 | |||
| gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739 | |||
| gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130 | |||
| gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368 | |||
| gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_031|beg|835|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaatctagcttaacaccaatTatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgattagaTttttaaaacagtTgcctacaatatcttcaagatctttagtagattttatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_033|beg|443|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tagtctaactttatttctaaacttaagaggtatctctggaattttaatagtccattgatttaatgattgaaaatatagacctgttccaccaactaaaattggaatttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_034|beg|1399|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tgctcctctaggttcatctaatttttcaacttcaTgcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcTaccaaattctat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt | |||
| Protein-Sequence | |||
| MVETKRGWLGVRIQVVSEEIA | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5432 to: 5488 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448 | |||
Coding-DNA |
|||
| aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt | |||
| Protein-Sequence | |||
| MVETKRGWLGVRIQVVSEEIA | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5432 to: 5488 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_035|beg|275|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| agatttagtcttagctaaccaatcatacatagatatatttgtataagatttaatctcataaTgctcttatggatctttgagtatcattttTggatcaaatttgTtctttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_036|beg|2480|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| gaattcactgtcagggtgataaaattaaagatTgtctgtccaccaattaaagcagtttcataggcttgcatcgcTtctgtagaaagcaaaaaattctgcatctcttccaaaaggcttctgcaaagatcttatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_043|beg|1462|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aacacccagccatcctcttttagttttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagagccTacctttacccaaaattgctgtgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag | |||
| Protein-Sequence | |||
| GSIGIGFSIPSNDAKRVVNQLIEFGE | |||
| Hit-Information Section | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912 | |||
| gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282 | |||
Coding-DNA |
|||
| tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag | |||
| Protein-Sequence | |||
| GSIGIGFSIPSNDAKRVVNQLIEFGE | |||
| Hit-Information Section | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912 | |||
| gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_044|beg|2597|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aaagatcttatttctttcaccatcaccttgaccccttcatTatttcagattctttattagcatttgctaaaattacagaaacatctttgtctgcagttgaagtaattgtaaccgccatctct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_045|beg|1646|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| attgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca | |||
| Protein-Sequence | |||
| GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS | |||
| Hit-Information Section | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383 | |||
| gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066 | |||
| gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057 | |||
| gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972 | |||
| gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462 | |||
| gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297 | |||
Coding-DNA |
|||
| ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca | |||
| Protein-Sequence | |||
| GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS | |||
| Hit-Information Section | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361 | |||
| gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645 | |||
| gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954 | |||
| gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883 | |||
| gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871 | |||
| gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093 | |||
| gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276 | |||
| gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755 | |||
| gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099 | |||
| gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668 | |||
| gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144 | |||
| gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024 | |||
| gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725 | |||
| gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373 | |||
| gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142 | |||
| gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902 | |||
| gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020 | |||
| gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257 | |||
| gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138 | |||
| gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600 | |||
| gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383 | |||
| gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066 | |||
| gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057 | |||
| gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554 | |||
| gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828 | |||
| gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490 | |||
| gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544 | |||
| gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972 | |||
| gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329 | |||
| gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462 | |||
| gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315 | |||
| gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531 | |||
| gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_048|beg|1081|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| atcttcatcattcaatggtcttacaattatttttaaagatttaatttcagaaattttcaggtgtttcttctttagtttcttttttttctactttaaaatccctctgaagtttcaagtcttcctagttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_049|beg|1380|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcaacactagTcaactaatgctcctctaggttcatctaatttttcTaacttcagcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa | |||
| Protein-Sequence | |||
| LIEFGETKRGWLGVRIQVVSEENC*S | |||
| Hit-Information Section | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69154 to: 69219 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6232 to: 6297 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001885 to: 2001950 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866277 to: 1866342 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065284 to: 2065349 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195428 to: 195493 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057219 to: 2057284 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396056 to: 1396121 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209735 to: 3209800 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887425 to: 1887490 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402442 to: 3402507 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904832 to: 904897 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117885 to: 2117950 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085398 to: 2085463 | |||
| gi-nr: gi|2094849 gi_def: R.capsulatus fdxE gene hsp_num: 1 from: 1102 to: 1152 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_052|beg|57|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tccaaggtaatttcatatttagatactgtgtcaattcggcaatcccaattaccttgtttacactctgatctttttaatttttTagtttaagaaattttttaaacttcaga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_053|beg|2036|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| aacatatcttcaaaaggtgatcctgggggaaactgaaaaccaggaaatggTatttagaatttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_054|beg|1446|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| aaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttTgcatcgttcatggtattggaaaaacc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct | |||
| Protein-Sequence | |||
| MQKRVVNQLIEFGETKRGWLGVRIQVV | |||
| Hit-Information Section | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112 | |||
Coding-DNA |
|||
| aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct | |||
| Protein-Sequence | |||
| MQKRVVNQLIEFGETKRGWLGVRIQVV | |||
| Hit-Information Section | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_055|beg|1556|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| atagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgagtttattgatgcatcagtttgTaatg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgag | |||
| Protein-Sequence | |||
| TQENSGGPLFDMNGDVIGINTAILGKGGS | |||
| Hit-Information Section | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176455 to: 8176526 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 2 from: 3517066 to: 3517137 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 5328805 to: 5328876 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 4 from: 1070315 to: 1070380 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5482594 to: 5482665 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887290 to: 1887364 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355803 to: 1355877 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349101 to: 1349175 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8706 to: 8780 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367196 to: 1367270 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364346 to: 1364420 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395921 to: 1395995 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316866 to: 2316928 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 4 from: 1040311 to: 1040373 | |||
| gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 661 to: 735 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065410 to: 2065484 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195554 to: 195628 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402568 to: 3402642 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6358 to: 6432 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909749 to: 2909823 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002011 to: 2002085 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556043 to: 2556117 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2989359 to: 2989430 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 365565 to: 365636 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69280 to: 69354 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 6049720 to: 6049797 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9948 to: 10007 | |||
| gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 1734087 to: 1734161 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 688 to: 747 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012230 to: 1012289 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798982 to: 799041 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227725 to: 3227799 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515190 to: 3515261 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294445 to: 2294519 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 2987759 to: 2987821 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8023 to: 8097 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1210084 to: 1210155 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455093 to: 2455155 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16333 to: 16398 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888447 to: 888521 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958967 to: 4959038 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044380 to: 1044451 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1910105 to: 1910176 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548810 to: 1548881 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163662 to: 163736 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322611 to: 3322685 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355156 to: 3355230 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470794 to: 3470868 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391623 to: 391697 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 2 from: 2029969 to: 2030031 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349243 to: 349317 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190627 to: 190701 | |||
| gi-nr: gi|2062623 gi_def: Mycobacterium tuberculosis sigma factor SigE (sigE) and HtrA (htrA) genes, complete cds hsp_num: 1 from: 3088 to: 3144 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193523 to: 1193585 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1081119 to: 1081181 | |||
| gi-nr: gi|32447713 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 22/24 hsp_num: 1 from: 37110 to: 37187 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 691053 to: 691112 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7720763 to: 7720825 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 5 from: 2481466 to: 2481525 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 6 from: 5421057 to: 5421116 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 7 from: 5699996 to: 5700058 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 3 from: 1234329 to: 1234391 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 3 from: 2622356 to: 2622418 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3858651 to: 3858722 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778195 to: 3778266 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127546 to: 1127617 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 92570 to: 92641 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4649671 to: 4649742 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 430500 to: 430559 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 1971130 to: 1971189 | |||
| gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 2 from: 301701 to: 301754 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367253 to: 1367315 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354728 to: 1354790 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389165 to: 1389227 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 530991 to: 531065 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 369668 to: 369742 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3979460 to: 3979534 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 4350958 to: 4351032 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 4189032 to: 4189106 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 3936027 to: 3936101 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 149224 to: 149298 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 4181024 to: 4181098 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 688840 to: 688905 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 4 from: 3446891 to: 3446950 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 1 from: 27894 to: 27953 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 1 from: 27362 to: 27421 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 1 from: 332508 to: 332570 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 4 from: 1167588 to: 1167650 | |||
| gi-nr: gi|32448029 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 23/24 hsp_num: 1 from: 213562 to: 213627 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 1 from: 600903 to: 600965 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035561 to: 1035623 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4315831 to: 4315884 | |||
| gi-nr: gi|157313474 gi_def: Thermotoga lettingae TMO, complete genome hsp_num: 1 from: 426172 to: 426234 | |||
| gi-nr: gi|149792434 gi_def: Thermosipho melanesiensis BI429, complete genome hsp_num: 1 from: 1781964 to: 1782026 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653436 to: 3653492 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170642 to: 5170698 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 4 from: 4084087 to: 4084146 | |||
| gi-nr: gi|145358489 gi_def: Arabidopsis thaliana serine-type peptidase/ trypsin (AT5G27660) mRNA, complete cds hsp_num: 1 from: 902 to: 952 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 2 from: 4238430 to: 4238486 | |||
| gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 3 from: 922705 to: 922761 | |||
| gi-nr: gi|125860746 gi_def: Methanoculleus marisnigri JR1, complete genome hsp_num: 1 from: 1350874 to: 1350936 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 4829762 to: 4829818 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 2 from: 4292609 to: 4292665 | |||
| gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 3 from: 944725 to: 944781 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 2 from: 4258127 to: 4258183 | |||
| gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 3 from: 938918 to: 938974 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 769134 to: 769193 | |||
| gi-nr: gi|699111 gi_def: Mycobacterium leprae cosmid B1756 hsp_num: 1 from: 22206 to: 22262 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091738 to: 1091791 | |||
| gi-nr: gi|145362659 gi_def: Arabidopsis thaliana DEGP8 (DEGP PROTEASE 8); serine-type peptidase/ trypsin (DEGP8) mRNA, complete cds hsp_num: 1 from: 957 to: 1016 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 3 from: 1071559 to: 1071612 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 1054235 to: 1054294 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 566585 to: 566644 | |||
| gi-nr: gi|154152641 gi_def: Fervidobacterium nodosum Rt17-B1, complete genome hsp_num: 1 from: 1103306 to: 1103368 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 1 from: 4965950 to: 4966009 | |||
| gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 2 from: 5178264 to: 5178323 | |||
| gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1370796 to: 1370852 | |||
| gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1368340 to: 1368396 | |||
| gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1396752 to: 1396808 | |||
| gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5011660 to: 5011716 | |||
| gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1366518 to: 1366574 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 4 from: 5412814 to: 5412873 | |||
| gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 333243 to: 333299 | |||
| gi-nr: gi|31617962 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 5/14 hsp_num: 1 from: 53674 to: 53730 | |||
| gi-nr: gi|24427855 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 16/29 hsp_num: 1 from: 43612 to: 43671 | |||
| gi-nr: gi|13092922 gi_def: Mycobacterium leprae strain TN complete genome; segment 4/10 hsp_num: 1 from: 241942 to: 241998 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 241283 to: 241342 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 2 from: 1583672 to: 1583731 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 2873145 to: 2873201 | |||
| gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 2 from: 426994 to: 427047 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 526 to: 579 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1039 to: 1092 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696340 to: 696399 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 1 from: 1123 to: 1176 | |||
| gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754517 to: 754576 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 988 to: 1041 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1084 to: 1137 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725853 to: 1725912 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 926924 to: 926983 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 718 to: 771 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 998 to: 1051 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 2 from: 338250 to: 338312 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_056|beg|1114|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| taaagatttaatttcagaaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTtctctcttttatttctccagattttaacatct | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt | |||
| Protein-Sequence | |||
| QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222 | |||
Coding-DNA |
|||
| aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt | |||
| Protein-Sequence | |||
| QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_057|beg|769|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaatttatttacctgatgcTagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagcttaacaccaatataTtcttctttggttttgattatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_058|beg|2464|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| taccTaaaaaatttaaagaattcactgtcaggtgataaaattTaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_059|beg|2772|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ctataaattTgcatcactgtttgcttgtggaaggtccgctcttttaattTctaacatcTtactattttaattccaaaactttcagcttcagtattacaccttcttgtattaaagccatttgtttagttctgtcttttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_061|beg|1861|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| gggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttgaataacatgattgttagtgattacaattccactctcttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga | |||
| Protein-Sequence | |||
| DQHQQPSLYILYHHQLELKYLLHF*I | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga | |||
| Protein-Sequence | |||
| DQHQQPSLYILYHHQLELKYLLHF*I | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_062|beg|2286|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| actgcaaaaattaacccaccacttcttaattgtTgaatcttttatcatctccattttttttaacaTtactttttcatttttgatggaaataaggcatataaaattccttctataaaaagaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_064|beg|755|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgcttgtccattattaatctagcttaacaccaatatatcttctttggttttgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt | |||
| Protein-Sequence | |||
| TSRSKIILISGPTASGKSNFAVKIA | |||
| Hit-Information Section | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167 | |||
| gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855 | |||
Coding-DNA |
|||
| tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt | |||
| Protein-Sequence | |||
| TSRSKIILISGPTASGKSNFAVKIA | |||
| Hit-Information Section | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167 | |||
| gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_065|beg|722|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| gtcggcattgatgattttccttcaatttttttgcaatcttaacagcaaaatttgatttaacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_066|beg|683|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaaatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa | |||
| Protein-Sequence | |||
| ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA | |||
| Hit-Information Section | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 2062845 to: 2062880 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766 | |||
Coding-DNA |
|||
| tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa | |||
| Protein-Sequence | |||
| ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA | |||
| Hit-Information Section | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 2062845 to: 2062880 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_069|beg|2328|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| atcatctccattttttttaacatacttttcatttttgatggaaataaggcatataaaattccttctataaaaaagaaaaagtccaaaagctataattagctctttcattttttagattaattttggt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_071|beg|2837|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| aattccaaaactttcacttcagtaTtttacTaccttcttgtatttaaagccatttgtttagttctgtcttttgaaagtaaagtttgtaattcttgctgacctagtacatttctcagtcttg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_072|beg|154|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttaacttcagaaatggctccattaTtttagcatgctagaagttcttaaattaattttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_073|beg|167|length|138|forward|gi | ||
| Query_DNA-Sequence | |||
| aatggctccattatttagcatgctagaagttcttaaattaattttttcaacaaTgcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaatcataca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_074|beg|1887|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| tatattctttatcaccatcaactcgaactaaaatatcttcTtgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttccttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttcct | |||
| Protein-Sequence | |||
| RKSAALGSGFIIEESGNCNH*Q | |||
| Hit-Information Section | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835395 to: 1835442 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209706 to: 1209753 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563083 to: 1563130 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165333 to: 7165380 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_076|beg|1506|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| gatttacaactctttttgcatcgttcgatggTtattgaaaaacctatccccTatagagccacctttacccaaaattgctgtgttaattccaattacatcaccattatatcaaataaaggt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_077|beg|74|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| atttagatactgtgtcaattcggcaatTcccaattaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatTggctccattatttagcatg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_078|beg|1251|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| ctacagttttaccaacttctgtttgtgcaacaattattggtaattctttcatcttttaatcttagtgttattaaaTctctaataTtTaatgtctcctgctttaattccgctttgtcagatgggctattt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_081|beg|2109|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| tcgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaatgaagtggtgcgtctttttgcaaacccttTgtgatgcaaactttattgTcaaaaaaataataaataattttttaat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaat | |||
| Protein-Sequence | |||
| FICGSGRKINAICCKLLQR | |||
| Hit-Information Section | |||
| gi-nr: gi|18997370 gi_def: Homo sapiens chromosome 1 clone RP3-445O10, complete sequence hsp_num: 2 from: 136366 to: 136413 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_086|beg|119|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| actctgatcttttttaattttttagtttaagaaaattttttaactttcagaaaatgggctccattatttagcatgcTtagaagttcttaaattaattttttcaacaagctttctctttttgtatcaatatgtagtt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_088|beg|917|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaacagtgcctacaatatcttcaagatctttagtagattttattttttttcttttgagcttcaacaataaacatctccaacatttaagtaatctTattgggctat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt | |||
| Protein-Sequence | |||
| NSAYNIFKIFSRFYFFS | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt | |||
| Protein-Sequence | |||
| NSAYNIFKIFSRFYFFS | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_091|beg|551|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctttttttgaatattttcaatttttttaattgttagttctaaccattgtcccTattgaaaatttttcattttaaatcaacaaaTtTccatTataaatgatgtttaatatttttttgtt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_092|beg|2471|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| aaatttaaagaattcactgtcaggtgataaaattaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcctctgtagaaagcaaaaaattTctgcatctcttccaaaggcttctgcaaagatc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_094|beg|1072|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgctcaaatatcttcatcattTcaatggtcttacaattatttttaaagatttaatttcagTaaatttcaTggtgtttcttctttagtttcttttttttctacttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_095|beg|2392|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| ctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattttttaggttttatgttaccaaaaaaatttaaagaattcTaTcttcaggtTgataaaaattaaagatgtctgtccac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_096|beg|169|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| tggctccattatttagcatgctagaagttcttTaaattaattttttcaacaagcttttctcttttgtatcaatatgtagttttaaaaagtcactatcattaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_097|beg|1751|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggTtataaatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgcttta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact | |||
| Protein-Sequence | |||
| PVKFGNSDQARIGDWVIAIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545 | |||
Coding-DNA |
|||
| aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct | |||
| Protein-Sequence | |||
| KATVVGADPLSDIAVLQIDSKKNL | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561 | |||
| gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515 | |||
| gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
Coding-DNA |
|||
| tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact | |||
| Protein-Sequence | |||
| PVKFGNSDQARIGDWVIAIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545 | |||
Coding-DNA |
|||
| aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct | |||
| Protein-Sequence | |||
| KATVVGADPLSDIAVLQIDSKKNL | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211 | |||
| gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561 | |||
| gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515 | |||
| gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_099|beg|1365|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| cagatTgggTctattttctgcaacactagcaactaatgctcctctaggttcatctaatttttcaacttcagcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaaTttctatcaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_104|beg|2272|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| ttataaaacctataactgcaaaaattaacccaccacttcttaattgtgTaatcttttatcatctccattttttttaacatacttttcatttttgatggaaataaggcTatataaaattccttctataaaaagaaaaagtcca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgTaatcttttatcatctccattttttttaacatacttttcatttttg | |||
| Protein-Sequence | |||
| LCNLLSSPFFLTYFSFL | |||
| Hit-Information Section | |||
| gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175 | |||
Coding-DNA |
|||
| gtgTaatcttttatcatctccattttttttaacatacttttcatttttg | |||
| Protein-Sequence | |||
| LCNLLSSPFFLTYFSFL | |||
| Hit-Information Section | |||
| gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_107|beg|306|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| gatatatttgtataagaTtttaatcTtcataagctcttatggTatctttgagTtaTtcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtccttctttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_108|beg|846|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| taacTaccaatatatcttctttggttttgaTttattgtaaattacaatTcaaaaTtagttttttgattagattttaaaacagtgcctacaaTtatcttcaagatcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_110|beg|1087|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| atcattcaatggtcttacaattatttttaaagatttaatttcagaaatttaggtgTtttcttctttagtttcttttttttctacTtttaaatcctctgaagttttcaagtcttcctagtttaattttttttgta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_113|beg|1503|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| attatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattccaattacatcaccattc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca | |||
| Protein-Sequence | |||
| LELTQQFWVKVASIGIGFSIPSNDAKRVVNN | |||
| Hit-Information Section | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746 | |||
| gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 2909695 to: 2909745 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427 | |||
| gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357 | |||
| gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545 | |||
Coding-DNA |
|||
| ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca | |||
| Protein-Sequence | |||
| LELTQQFWVKVASIGIGFSIPSNDAKRVVNN | |||
| Hit-Information Section | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064 | |||
| gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879 | |||
| gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891 | |||
| gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746 | |||
| gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517 | |||
| gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243 | |||
| gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781 | |||
| gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688 | |||
| gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308 | |||
| gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 2909695 to: 2909745 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742 | |||
| gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639 | |||
| gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234 | |||
| gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427 | |||
| gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357 | |||
| gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969 | |||
| gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_117|beg|1566|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| ctttacccaaaattctgtgttaattccaattacatcaccattcatatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataaccgagaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa | |||
| Protein-Sequence | |||
| VMKITFKHMHQINSGNSGGPLFEYE | |||
| Hit-Information Section | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5328856 to: 5328888 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209906 to: 3209947 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575 | |||
| gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 1210072 to: 1210104 | |||
| gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586 | |||
| gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097 | |||
| gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637 | |||
| gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608998 to: 3609039 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321014 to: 2321055 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773 | |||
| gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 365616 to: 365648 | |||
| gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774 | |||
| gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219 | |||
| gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782 | |||
| gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612 | |||
| gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666 | |||
| gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830 | |||
| gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2030011 to: 2030043 | |||
| gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893 | |||
| gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122 | |||
| gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663 | |||
| gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539 | |||
| gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156 | |||
| gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590 | |||
| gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394 | |||
| gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490 | |||
| gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957 | |||
| gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398 | |||
| gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514 | |||
| gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631 | |||
| gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945 | |||
| gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648 | |||
| gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734 | |||
| gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587 | |||
| gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265 | |||
| gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290 | |||
| gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151 | |||
| gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582 | |||
| gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122 | |||
| gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879 | |||
| gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899 | |||
| gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071 | |||
| gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905 | |||
| gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035 | |||
| gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891 | |||
| gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995 | |||
| gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008 | |||
| gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034 | |||
Coding-DNA |
|||
| atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa | |||
| Protein-Sequence | |||
| VMKITFKHMHQINSGNSGGPLFEYE | |||
| Hit-Information Section | |||
| gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5328856 to: 5328888 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034 | |||
| gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209906 to: 3209947 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950 | |||
| gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575 | |||
| gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023 | |||
| gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444 | |||
| gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 1210072 to: 1210104 | |||
| gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586 | |||
| gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097 | |||
| gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637 | |||
| gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255 | |||
| gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608998 to: 3609039 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321014 to: 2321055 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773 | |||
| gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 365616 to: 365648 | |||
| gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774 | |||
| gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219 | |||
| gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782 | |||
| gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58 | |||
| gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612 | |||
| gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666 | |||
| gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491 | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710 | |||
| gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830 | |||
| gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2030011 to: 2030043 | |||
| gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893 | |||
| gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122 | |||
| gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663 | |||
| gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539 | |||
| gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534 | |||
| gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839 | |||
| gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766 | |||
| gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156 | |||
| gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590 | |||
| gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394 | |||
| gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490 | |||
| gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957 | |||
| gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949 | |||
| gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398 | |||
| gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514 | |||
| gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631 | |||
| gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945 | |||
| gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648 | |||
| gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734 | |||
| gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587 | |||
| gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265 | |||
| gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290 | |||
| gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151 | |||
| gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720 | |||
| gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423 | |||
| gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920 | |||
| gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582 | |||
| gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122 | |||
| gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879 | |||
| gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899 | |||
| gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071 | |||
| gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905 | |||
| gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035 | |||
| gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891 | |||
| gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995 | |||
| gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008 | |||
| gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_119|beg|2677|length|107|forward|gi | ||
| Query_DNA-Sequence | |||
| caTtctttgtctgcagTttgTaagtaattgtaaccgccatctctTgcacctcttgctctaaattcttttgcttctctttccctttcagtctgcattcttctataaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_120|beg|1135|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaggtgtttTcttctttagtttctttttttttctactttaaaatcctctgaagtttcaagtcTttcctagtttaattttttttgtaatctctcttttatttctccagatttaacatctacagttttaccaact | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_121|beg|2188|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| cccttgtgatgcaaaacttattgcaaaaaatataataaataatttttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccTacttcttaattgtgaatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_122|beg|2648|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| tttattagcTatttgctaaaattaagaaacatctttgtctgcagttgaagtaattgtaaccgccatctctgcTacctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctataaattgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat | |||
| Protein-Sequence | |||
| MLPLALNSFASLSFQVCILL*I | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat | |||
| Protein-Sequence | |||
| MLPLALNSFASLSFQVCILL*I | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_124|beg|1867|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| agcaccaacaaccgtcTgctttatattctttatcaccatTcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtTgattacaattccactctcttctattataaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_125|beg|399|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaagttttttataaaattttttttgtccttTctttttaacattagtctaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatataga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_127|beg|429|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| tcttttttagacattagtctaactttattttctaaacttaagaggtatTctctggaaTttttaactagtccattgattaatgattgaaaatataacctgttccaccaactaaaattgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_129|beg|649|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| gtttaaatttttttgttcttgcttgttgggtcttgcagttaatattttttaatttttgtaaaacctgcatacttcggcattgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_130|beg|412|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| aaattttttttcccttcttttttagacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatTattgaaaatatagacctgttccaccaactaaaattggaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt | |||
| Protein-Sequence | |||
| LINGLVKIPEIPLKFRNKVKTNV*K | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949 | |||
| gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247 | |||
| gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590 | |||
Coding-DNA |
|||
| gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt | |||
| Protein-Sequence | |||
| LINGLVKIPEIPLKFRNKVKTNV*K | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949 | |||
| gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247 | |||
| gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_131|beg|1189|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaagtcttcctagtttaatttttttttgtaatctctcttttatttcccagattttaacatctacagttttaccaacttctgttttgtgcaacaattattggtaattc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_134|beg|2655|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| gcatttgctaaaaattacagaaacatctttgtctgcattgaagtaattgtaaccgccatctctgcacctcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgcatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca | |||
| Protein-Sequence | |||
| TSCSKILLLLFPFQSAFFYKLH | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca | |||
| Protein-Sequence | |||
| TSCSKILLLLFPFQSAFFYKLH | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_135|beg|1571|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| cccaaaattgctgtgttaattccaattTacatcaccattcatatcaaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga | |||
| Protein-Sequence | |||
| SIGLSRYEDYIQTDASINSGNQADLYLI | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038184 to: 1038243 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 2205020 to: 2205067 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777178 to: 777240 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2466995 to: 2467057 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887248 to: 1887292 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367268 to: 1367312 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364418 to: 1364462 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355875 to: 1355919 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349173 to: 1349217 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1177848 to: 1177910 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 446564 to: 446626 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1158669 to: 1158731 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1157008 to: 1157070 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1277786 to: 1277848 | |||
| gi-nr: gi|2077988 gi_def: C.jejuni htrA gene hsp_num: 1 from: 657 to: 719 | |||
| gi-nr: gi|881374 gi_def: Campylobacter jejuni heat shock protein/serine protease (htrA) and OmpR protein (ompR) genes, partial cds hsp_num: 1 from: 300 to: 362 | |||
| gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8664 to: 8708 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 821479 to: 821538 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418555 to: 2418599 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617821 to: 2617865 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175321 to: 5175380 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535290 to: 2535349 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455153 to: 2455212 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835722 to: 1835769 | |||
| gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 682 to: 720 | |||
| gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 490 to: 528 | |||
| gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 952 to: 990 | |||
| gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1048 to: 1086 | |||
| gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 962 to: 1000 | |||
| gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1003 to: 1041 | |||
| gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008 | |||
| gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008 | |||
| gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325713 to: 325757 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316824 to: 2316868 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904655 to: 904699 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118083 to: 2118127 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057417 to: 2057461 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395879 to: 1395923 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085596 to: 2085640 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 29111 to: 29155 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563416 to: 1563460 | |||
| gi-nr: gi|1184674 gi_def: Pseudomonas aeruginosa HtrA-like serine protease AlgW gene, complete cds hsp_num: 1 from: 647 to: 691 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_136|beg|1888|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| atattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaataacatgattgttTagtgattacaattccactctcttctattataaatcctgaaccaagtgca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaata | |||
| Protein-Sequence | |||
| ILYHHQLETKNLLHFE*H | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_137|beg|1463|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| acacccagccatcctttttagtttcaccaaattctatcaattgatttacaaactctttttcatcgttcgatggtattgaaaaaccTtatcccaatagagccacctttacccaaaatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_139|beg|1739|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| aagccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtataaatttttcttttgaatctatttgaagggactgcaatatcagataaagg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat | |||
| Protein-Sequence | |||
| FIPVKFGNSDQARIGDWVIAIGQSLWL | |||
| Hit-Information Section | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009 | |||
Coding-DNA |
|||
| agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat | |||
| Protein-Sequence | |||
| FIPVKFGNSDQARIGDWVIAIGQSLWL | |||
| Hit-Information Section | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207 | |||
| gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_141|beg|506|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| tgattgaaaataTtagacctgttccaccaactaaaattggaatttttttctttttttgaatattttcaattttttttaattgttagttctaaccattgtccagTttgaaatttttcatttaaatcaacTa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_143|beg|976|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaacaataacatctccaacatttaagtaatctattTgggctattttttccaatatttgttataactaaaccgttgtttgattgggtaattttctttgctcaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_144|beg|430|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| cttttttagacattagtctaactttatttctaaacttTaagaggtatctctggaattttaactagccattgattaatgattgaaatatagacctgttcccaccaactaaaattggaatttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_146|beg|2552|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| tcTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacccttcatgatttcagattctttattagcatttgctaaaattacagaaaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacc | |||
| Protein-Sequence | |||
| RVKVNGERNKIFAEAFGRDAEFFAFYK | |||
| Hit-Information Section | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417151 to: 2417219 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610391 to: 3610459 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2119180 to: 2119254 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086693 to: 2086767 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_147|beg|2563|length|138|forward|gi | ||
| Query_DNA-Sequence | |||
| caaaaaattctgcTatctcttccaaaggctttctgcTaaagatcttatttctttcaccatcaccttgacccttTcatgatttcagattctttattagcatttgctaaattacagaaacaTtctttgtcTtgcagttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_148|beg|1090|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| attcaatgtcttacaattatttttaaagatttaatttcagaaatttcaggtgTtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgaatctc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_150|beg|845|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaacaccaatatatcttctttggtttttgattattgtaaattacaatcaaaatagttttttgatttagattttaaaacagttgcctacaatatcttcaagatctttagtagattttattttttttcttttTgagcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_151|beg|2095|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtcttttgcaaacccttgtgatgcaaaact | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt | |||
| Protein-Sequence | |||
| QKNAPASFADLAEKLMPSVVNISTNDNSYY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
Coding-DNA |
|||
| gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt | |||
| Protein-Sequence | |||
| QKNAPASFADLAEKLMPSVVNISTNDNSYY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800 | |||
| gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_157|beg|812|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| aattttggactgcttgtccattattaaTtctagcttaacaccaaatatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgaTttagattttaaaacagtgccctacaataTtcttcaagatcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_159|beg|2326|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| ttatcatctccattttttaacatacttttcatttttgatggaaataaggcatataaattcctttataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_160|beg|726|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| gcattgatgatttctccttcaattttttttgcaatcttTaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagctaacaTccaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_161|beg|2351|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| acttttcatttttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattgctctttcattattttTagattaattttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_168|beg|456|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatatagacTtgttccaccaactaaaattggaatttttttTctttttttgaatattttcaatttttttaattg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_171|beg|2344|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaacatacttttcattttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaatttttaggttttatgttaccaaaaaaatttaaagaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_172|beg|2130|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| cagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaataattttttaattctgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaa | |||
| Protein-Sequence | |||
| DGINFSARSANEAGASFANPCDAKLIAKNIIK | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6132 to: 6233 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_173|beg|2099|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| gtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaactt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVKHFYNDNSY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153 | |||
Coding-DNA |
|||
| taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca | |||
| Protein-Sequence | |||
| FAKDAPASFADLAEKLMPSVVKHFYNDNSY | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_174|beg|118|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| cactctgatcttttttaatttttagtttaagaaattttttaacttcTagaaatggctccattattttagcatgctagaaTttcttaaattaatttttcaacaacttttctctttttga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_176|beg|703|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat | |||
| Protein-Sequence | |||
| ILISGPTASGKSNFALRLQKKLKGEIINADSMQVYK | |||
| Hit-Information Section | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2665684 to: 2665791 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 447944 to: 448048 | |||
| gi-nr: gi|145361991 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|145358247 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|14532863 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 157 to: 264 | |||
| gi-nr: gi|13430591 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 272 to: 379 | |||
| gi-nr: gi|21404588 gi_def: Arabidopsis thaliana clone 19250 mRNA, complete sequence hsp_num: 1 from: 347 to: 454 | |||
| gi-nr: gi|14279069 gi_def: Arabidopsis thaliana AtIPT9 mRNA for tRNA isopentenyltransferase, complete cds hsp_num: 1 from: 157 to: 264 | |||
| gi-nr: gi|147865869 gi_def: Vitis vinifera contig VV78X183130.5, whole genome shotgun sequence hsp_num: 1 from: 17496 to: 17597 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_178|beg|798|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| cctgTaaattaagataattttggactgcttgtccattattaatctagcttaacTaccaatatatcttctttggTtttttgattattgtaaattacaatcaaaatagttttttgatagatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_180|beg|1876|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| aaccgtcgctttatattctttatcaccTatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcaTgcagacttccttgtt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca | |||
| Protein-Sequence | |||
| MEIVITNNHVIQNAEDILVRVDR | |||
| Hit-Information Section | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510 | |||
| gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586 | |||
Coding-DNA |
|||
| Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca | |||
| Protein-Sequence | |||
| MEIVITNNHVIQNAEDILVRVDR | |||
| Hit-Information Section | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808 | |||
| gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510 | |||
| gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_184|beg|2553|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcaccatcaccttgacccttcatgatttcagattctttaTttagcatttgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca | |||
| Protein-Sequence | |||
| CRKQKILHLFQRLLQMILFLSP | |||
| Hit-Information Section | |||
| gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879 | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317 | |||
| gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216 | |||
| gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555 | |||
| gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692 | |||
| gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175 | |||
| gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353 | |||
| gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857 | |||
| gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104 | |||
Coding-DNA |
|||
| tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca | |||
| Protein-Sequence | |||
| CRKQKILHLFQRLLQMILFLSP | |||
| Hit-Information Section | |||
| gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879 | |||
| gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317 | |||
| gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216 | |||
| gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555 | |||
| gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692 | |||
| gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175 | |||
| gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353 | |||
| gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857 | |||
| gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655 | |||
| gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_186|beg|1013|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| gggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaaagatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_187|beg|162|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| tcagaaaTtggctccattatttagcatgctagaagttcttaaattaatttttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_188|beg|62|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| ggtaatttcatcatttagatactgtgtcaattcggcaatcccaattaccTttTgtttacactctgatcttttttaatttttagtttTaagaaattttttaactt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_191|beg|1166|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| tctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaatctctcttttatttctccagattttaacatctacagtttttaccaacttctgtttgtgcaacaattattggtaattct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_192|beg|2154|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gatccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattgcaaaaaatataataaataattttttaaattctgttctttaactttttatataccaaataattataaaacctataactgca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg | |||
| Protein-Sequence | |||
| CNKFCITKGFAKRRTTSFAD | |||
| Hit-Information Section | |||
| gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703 | |||
| gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660 | |||
Coding-DNA |
|||
| atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg | |||
| Protein-Sequence | |||
| CNKFCITKGFAKRRTTSFAD | |||
| Hit-Information Section | |||
| gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703 | |||
| gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_193|beg|2191|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaTtaactgTcaaaaattaacccaccacttcttaatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT | |||
| Protein-Sequence | |||
| VMQNLIAKNIINNFLIRHFNFLLPNNYKTY | |||
| Hit-Information Section | |||
| gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081 | |||
Coding-DNA |
|||
| tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT | |||
| Protein-Sequence | |||
| VMQNLIAKNIINNFLIRHFNFLLPNNYKTY | |||
| Hit-Information Section | |||
| gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_196|beg|644|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| atgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacac | |||
| Protein-Sequence | |||
| LIFFCSCLLGLAVNIFNFFVNLSYCLALMISPSIFFAILT | |||
| Hit-Information Section | |||
| gi-nr: gi|18250105 gi_def: Homo sapiens BAC clone RP11-9N12 from 4, complete sequence hsp_num: 2 from: 89832 to: 89855 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_197|beg|1777|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| aattcttgcTttgatcagaatttccaaatttaaTctggtataaatttttcttttgaatTctatttgaaggactgcaatatcaataagggatcTagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_198|beg|2133|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| atggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaacttttttatata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt | |||
| Protein-Sequence | |||
| AKDAPASFADLAEKLMP | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166 | |||
Coding-DNA |
|||
| tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt | |||
| Protein-Sequence | |||
| AKDAPASFADLAEKLMP | |||
| Hit-Information Section | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_201|beg|1222|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| ctctcttttatttctccagaTttttaacaTtctaTcagttttaccaacttctgtttgtgcTaacaattTattggtaattctttcatctctttaatcttagtgtta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_206|beg|1287|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaacactagcaactaatgctc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa | |||
| Protein-Sequence | |||
| CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP | |||
| Hit-Information Section | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279 | |||
Coding-DNA |
|||
| tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa | |||
| Protein-Sequence | |||
| CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP | |||
| Hit-Information Section | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111 | |||
| gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_207|beg|706|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtaaacctgcatactgtcggcttgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttacctgtgcagtcggtcctgaaattaag | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_208|beg|2200|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaacttattgcaaaaaatataataaataattttttaattctgttcattttTaacttttttatataccaaataattataaaacctataactgcaaaaattaacccacccacttcttaattgtgaatct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_211|beg|947|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| ttagtagattttattttttttcttttgagcttTcaacaataacatctccaacatttaagtaatctattgggctattttttccaatatttgttaTtaactaaacct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_213|beg|491|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| tagtccattgattaatgattgaaaatatagacctgttccaccaactaaaattggaatttttttttctttttttgaaattattttcaatttttttaattgttagttctaaccattgtccagttgaaaatttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_214|beg|1317|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| tgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgcaactaatctcctctaggtcatctaatttttc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc | |||
| Protein-Sequence | |||
| LHSVAENSPSDKAGIKAGDIILEFNN | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528 | |||
Coding-DNA |
|||
| gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc | |||
| Protein-Sequence | |||
| LHSVAENSPSDKAGIKAGDIILEFNN | |||
| Hit-Information Section | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_215|beg|889|length|99|forward|gi | ||
| Query_DNA-Sequence | |||
| aatcaaaatagtttttgattagatttttaaaacagtgcctacaatatcttcaaatctttagtagattttatttttttctttgagcttcaacaataacat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_216|beg|369|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| aatttgtcttttgaTttttaggatcaagttttaaaagttttttataaaattttttttgtccttctttttttagacattaTgtctaactttatttctaaacttaagaggtatctctgga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_217|beg|1018|length|100|forward|gi | ||
| Query_DNA-Sequence | |||
| attttttccaatatttgttTataactaaacctgttgtttgattgggtaattttttgctcaatatcttcatcattcaatgggtcttacaattatttttaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_218|beg|2103|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| tgttgtcgttgtagaaatgttacaacagatggTcattaattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaataatttttt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata | |||
| Protein-Sequence | |||
| IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN** | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233 | |||
| gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525 | |||
Coding-DNA |
|||
| taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata | |||
| Protein-Sequence | |||
| IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN** | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233 | |||
| gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_220|beg|938|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| tcaagatctttagtagattttatttttttcttttggcttcaacaataacatctccaacatttaaagtaattctattgggctattttttccaatattgttataactaaaccc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_224|beg|149|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| aaattttttaacttcagaaaTtggctccattatttagcatgctagaagttcttaaattaattttttcaacaagTcttttctctttttgtTatcaatatggtagttttTaaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_229|beg|1420|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| tttttcaacttcacaatttcttcagaaacttacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaacctatcccaatag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa | |||
| Protein-Sequence | |||
| VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920 | |||
Coding-DNA |
|||
| aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa | |||
| Protein-Sequence | |||
| VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ | |||
| Hit-Information Section | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_232|beg|456|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tttctaaacttaagaggtatctctggaaatttttaactagtccattgattaatgattgaaaatatTagacctgttccaccaactaaaattggaattttttttcttttttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_233|beg|1242|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttaacatctacaTgttttaccaacttctgtttgtgcaacaattattggtaattctttcatctTctttaatcttagtgtttattaaactctaatataatgtctcctgcttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_234|beg|2186|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| aacccttgtgatgcaaaacttattgcaaaaaataTtaataaatTaattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_235|beg|1926|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcattttgaataacttgattgttagtgattacaattccactctcttctattataaatccTtgTaaccaagtgcagcagaTcttccttgtttgaggtgttccaaattctttTgaacatatcttcaaaaggtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat | |||
| Protein-Sequence | |||
| GFIIEESGIVITNNQVIQNA | |||
| Hit-Information Section | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370 | |||
Coding-DNA |
|||
| tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat | |||
| Protein-Sequence | |||
| GFIIEESGIVITNNQVIQNA | |||
| Hit-Information Section | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734 | |||
| gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752 | |||
| gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_236|beg|39|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| attaactcttctgcttcatccaaggtaatttcatcatttagatactgtgtcaattcggcaatcccaatttaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatggctccat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_238|beg|298|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| catacatagatatattgtataagatttaatctcataagctcttatggatctttgagtTatcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_239|beg|1785|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| cttgatcagaatttccaaaatttaactggtataaatttttcttttgaatctatttgaaggactgcaatatagataagggatcagcaTccaacaaccgtcgcttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_240|beg|2650|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| tattagcatttgctaaaattacagaaacTatctttgtctgcagttgaagtaattgtaaccgccatctctgcacctttgctctaaattcttttgcTttctctttccctttcagtctgcattct | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_242|beg|2685|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tctgcagttgaagtaattgtaaccgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcctgcattcttctataaattgcatcTactgTtttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc | |||
| Protein-Sequence | |||
| NRHLCTSCLNSLLLFPFQS | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728 | |||
| gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836 | |||
| gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331 | |||
Coding-DNA |
|||
| accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc | |||
| Protein-Sequence | |||
| NRHLCTSCLNSLLLFPFQS | |||
| Hit-Information Section | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728 | |||
| gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836 | |||
| gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_243|beg|2274|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| aTtaaaacctataactgcaaaaattaacccaccacttcttaattgtgaatcttttatcatctccatttttttaacatacttttcattttgatggaaataaggcatataaaattccttc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_244|beg|2261|length|100|forward|gi | ||
| Query_DNA-Sequence | |||
| ataccaaaTtaattataaaacctataacTtgcaaaattaacccaccacttTcttaattgtgaatcttttatcatctccattttttaacatacttttcatt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_245|beg|865|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| ttggttttgattatttgtaaattTacaatcaaaatagttttttgattagattttaaaacagtgcctacaatatcttcaagatctttagtagattttatttttttcttttgagcttca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_247|beg|40|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| ttaactcttctgcttcatccaaggtaatttcaTtcatttagatactgtTtcaattcggcaatcccaattaccttgtttacactctgatTctttttttaatttttaTgtttaagaaattttta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_248|beg|2769|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| cttctataaattgcatcactgttttgcttgtggaaggtccgctcttttaatttctaacatctTactattttaattccaaaactttcagcttcagtatttacaccttcttgTtattaaagccatttgtttag | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_249|beg|2033|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaacatacttTcaaaaggtgatcctgggggaaactgaaaaccaggaaatggattagaatttgtagtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccTagatccgca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_001|beg|1112|length|144|forward|gi | ||
| Query_DNA-Sequence | |||
| agtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctgatggaagtgga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctg | |||
| Protein-Sequence | |||
| SEALGKDKIVAFKPRSFNAILARVNLVLHPMKLGLDLRGWCAFPD | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 7 from: 439923 to: 439955 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 754813 to: 754845 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057551 to: 1057583 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617211 to: 617243 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123700 to: 1123741 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512623 to: 3512664 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984131 to: 2984172 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551741 to: 3551782 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123988 to: 1124029 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051128 to: 1051169 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 358 to: 399 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 358 to: 399 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650563 to: 2650604 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245634 to: 3245675 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635663 to: 1635704 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479619 to: 1479660 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622164 to: 1622205 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245607 to: 2245648 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241641 to: 2241682 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219100 to: 2219141 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376708 to: 3376749 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847374 to: 2847415 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40139 to: 40183 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274892 to: 1274933 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109746 to: 1109787 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145064 to: 1145105 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6379 to: 6420 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11911 to: 11952 | |||
Coding-DNA |
|||
| gtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctg | |||
| Protein-Sequence | |||
| SEALGKDKIVAFKPRSFNAILARVNLVLHPMKLGLDLRGWCAFPD | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 7 from: 439923 to: 439955 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 754813 to: 754845 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057551 to: 1057583 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617211 to: 617243 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123700 to: 1123741 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512623 to: 3512664 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984131 to: 2984172 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551741 to: 3551782 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123988 to: 1124029 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051128 to: 1051169 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 358 to: 399 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 358 to: 399 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650563 to: 2650604 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245634 to: 3245675 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635663 to: 1635704 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479619 to: 1479660 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622164 to: 1622205 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245607 to: 2245648 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241641 to: 2241682 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219100 to: 2219141 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376708 to: 3376749 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847374 to: 2847415 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40139 to: 40183 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274892 to: 1274933 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109746 to: 1109787 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145064 to: 1145105 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6379 to: 6420 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11911 to: 11952 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_002|beg|1658|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| atcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgctggcTagcgaaatca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgc | |||
| Protein-Sequence | |||
| ILGATATLEFREVDDKADLCRCGSRTCAC | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287368 to: 287424 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439335 to: 439406 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755362 to: 755433 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204783 to: 2204854 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058100 to: 1058156 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617760 to: 617816 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130252 to: 130308 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245157 to: 3245213 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3044899 to: 3044928 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337053 to: 337109 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882086 to: 2882139 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274669 to: 3274722 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732319 to: 1732372 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240468 to: 3240521 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803316 to: 2803372 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 394005 to: 394034 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650086 to: 2650142 | |||
Coding-DNA |
|||
| tcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgc | |||
| Protein-Sequence | |||
| ILGATATLEFREVDDKADLCRCGSRTCAC | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287368 to: 287424 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439335 to: 439406 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755362 to: 755433 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204783 to: 2204854 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058100 to: 1058156 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617760 to: 617816 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130252 to: 130308 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245157 to: 3245213 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3044899 to: 3044928 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337053 to: 337109 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882086 to: 2882139 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274669 to: 3274722 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732319 to: 1732372 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240468 to: 3240521 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803316 to: 2803372 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 394005 to: 394034 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650086 to: 2650142 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_003|beg|2862|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| tgaagtggctttgaacagcctgccaatcTtggagcaaatccgtagcgcccttgaagcTgaaaggttttggtgatgctaccgtgcaaacttttggttctgcacgtgatgtgatggTtacgtctacgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcccttgaagcTgaaaggttttggtgatgctaccgtgcaaacttttggttctgcacgtgatgtgatggTtacgtctacg | |||
| Protein-Sequence | |||
| APLKLKGFGDATVQTFGSARDVMVTST | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756615 to: 756680 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438088 to: 438153 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1059347 to: 1059418 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 619013 to: 619078 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_011|beg|1221|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| gtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcgatccgtccattatcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcg | |||
| Protein-Sequence | |||
| SRGKRIFSSRRSLRKASSCWLTNFSIAASISTSIRKCTPP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617321 to: 617428 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057661 to: 1057768 | |||
| gi-nr: gi|212803 gi_def: Chicken tropoelastin mRNA, complete cds hsp_num: 2 from: 1250 to: 1285 | |||
| gi-nr: gi|212741 gi_def: Chicken tropoelastin mRNA, 3' end hsp_num: 2 from: 1069 to: 1104 | |||
| gi-nr: gi|74195328 gi_def: Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library, clone:G370038P06 product:unclassifiable, full insert sequence hsp_num: 1 from: 1271 to: 1312 | |||
| gi-nr: gi|121713911 gi_def: Aspergillus clavatus NRRL 1 C2H2 type zinc finger domain protein (ACLA_015870) mRNA, complete cds hsp_num: 2 from: 629 to: 667 | |||
Coding-DNA |
|||
| tggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcg | |||
| Protein-Sequence | |||
| SRGKRIFSSRRSLRKASSCWLTNFSIAASISTSIRKCTPP | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617321 to: 617428 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057661 to: 1057768 | |||
| gi-nr: gi|212803 gi_def: Chicken tropoelastin mRNA, complete cds hsp_num: 2 from: 1250 to: 1285 | |||
| gi-nr: gi|212741 gi_def: Chicken tropoelastin mRNA, 3' end hsp_num: 2 from: 1069 to: 1104 | |||
| gi-nr: gi|74195328 gi_def: Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library, clone:G370038P06 product:unclassifiable, full insert sequence hsp_num: 1 from: 1271 to: 1312 | |||
| gi-nr: gi|121713911 gi_def: Aspergillus clavatus NRRL 1 C2H2 type zinc finger domain protein (ACLA_015870) mRNA, complete cds hsp_num: 2 from: 629 to: 667 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_012|beg|1245|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| aaagtggatatggatgccgcgatggaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcTgttaccgcgTcgatccgtccattatcggatgcggttgaagtgaccctgcgtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagtggatatggatgccgcgatggaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcTgttaccgcgT | |||
| Protein-Sequence | |||
| SGYGCRDGKLVSQQEEAFRSDLRDEKILLPR | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754972 to: 755028 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439740 to: 439796 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617370 to: 617426 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057710 to: 1057766 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_017|beg|190|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcatcTatcggatcgctgtaacgaaatcctcgtgcacgcttgaatactatccataacctgcgttactaccaacgcTttgatggaaagcattcgtaagcgattgatgaagaccgtttt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cctcgtgcacgcttgaatactatccataacctgcgttactaccaacgcTttgatggaaagcattcg | |||
| Protein-Sequence | |||
| NPRARLNTIHNLRYYQRFDGKHS | |||
| Hit-Information Section | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3637 to: 3720 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117286 to: 1117369 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804714 to: 2804755 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651447 to: 2651488 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900525 to: 1900566 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478675 to: 1478716 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335694 to: 335735 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3495841 to: 3495882 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245106 to: 245144 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267523 to: 267561 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168894 to: 1168935 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364022 to: 3364060 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883444 to: 2883482 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730684 to: 2730722 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276026 to: 3276064 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730976 to: 1731014 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665275 to: 1665313 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246516 to: 3246554 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681931 to: 1681969 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610503 to: 1610541 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634781 to: 1634819 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241825 to: 3241863 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696831 to: 2696872 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163250 to: 3163291 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551269 to: 551310 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_019|beg|543|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgaaaatgatcatcatgctcgcgatgttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatg | |||
| Protein-Sequence | |||
| CFAVIFYFMIYRPQAKRVKEHKNLMAAM | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616668 to: 616748 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057008 to: 1057088 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205898 to: 2205978 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440418 to: 440498 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754270 to: 754350 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129159 to: 129239 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154884 to: 1154964 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335963 to: 336043 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2286090 to: 2286170 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246218 to: 3246298 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 727093 to: 727173 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274262 to: 1274333 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622752 to: 1622817 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2242229 to: 2242294 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219688 to: 2219753 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2246195 to: 2246260 | |||
Coding-DNA |
|||
| ttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatg | |||
| Protein-Sequence | |||
| CFAVIFYFMIYRPQAKRVKEHKNLMAAM | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616668 to: 616748 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057008 to: 1057088 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205898 to: 2205978 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440418 to: 440498 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754270 to: 754350 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129159 to: 129239 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154884 to: 1154964 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335963 to: 336043 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2286090 to: 2286170 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246218 to: 3246298 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 727093 to: 727173 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274262 to: 1274333 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622752 to: 1622817 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2242229 to: 2242294 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219688 to: 2219753 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2246195 to: 2246260 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_020|beg|164|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| ttgcaaaaattattcgaagtcatacctgcatTcatctggatcTgctgtaacgaaacctcggtgcacggcttgaatactatccataacctgcgttactaccaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcaaaaattattcgaagtcatacctgcatTcatctggatcTgctgtaacgaaacctcggtgcacggcttgaatactatccataacctgcgttactaccaa | |||
| Protein-Sequence | |||
| LQKLFEVIPAFIWICCNETSVHGLNTIHNLRYYQ | |||
| Hit-Information Section | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364022 to: 3364078 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276026 to: 3276082 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665257 to: 1665313 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241825 to: 3241881 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681913 to: 1681969 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730958 to: 1731014 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610485 to: 1610541 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883444 to: 2883500 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627265 to: 627321 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128880 to: 128936 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 2 from: 988 to: 1020 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 2 from: 1066 to: 1098 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 971310 to: 971342 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1161473 to: 1161505 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1091110 to: 1091142 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 825542 to: 825574 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 829198 to: 829230 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1130170 to: 1130202 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1130121 to: 1130153 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 827297 to: 827329 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245085 to: 245141 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976504 to: 976560 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300220 to: 300249 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 692933 to: 692965 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 898882 to: 898914 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295623 to: 295655 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_021|beg|686|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTttcgtTgactgcagtgctaccaaaaTgggtacgctgaaatctctttaaaacgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTtt | |||
| Protein-Sequence | |||
| GSYLLRLLKITLTSQFELNTNNEVVIKKDF | |||
| Hit-Information Section | |||
| gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 5 from: 250 to: 291 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 286444 to: 286485 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 795734 to: 795775 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616833 to: 616874 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754476 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440292 to: 440333 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057214 | |||
Coding-DNA |
|||
| tgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTtt | |||
| Protein-Sequence | |||
| GSYLLRLLKITLTSQFELNTNNEVVIKKDF | |||
| Hit-Information Section | |||
| gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 5 from: 250 to: 291 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 286444 to: 286485 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 795734 to: 795775 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616833 to: 616874 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754476 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440292 to: 440333 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057214 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_022|beg|1752|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| aaatcTaagttcgatcgtaatggTtcgtcctgtggtgctgaaaaagcgcgtTgattctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggtgaacatttcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcgcgtTgattctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggtgaacatttcg | |||
| Protein-Sequence | |||
| SALILGGSSITDASSSADEYGRPQVNIS | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204636 to: 2204722 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058232 to: 1058318 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130384 to: 130470 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439188 to: 439274 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755494 to: 755580 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617892 to: 617978 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_023|beg|2375|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgttgacgggtcgggtatggcggtcTgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgccgatgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgcc | |||
| Protein-Sequence | |||
| RRKNPQLSDSSMVTLTHSVPLP | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| aaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgcc | |||
| Protein-Sequence | |||
| RRKNPQLSDSSMVTLTHSVPLP | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_024|beg|2600|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| atttttaaccttatgttttaccgcgattgtgggtacacgtttgtatcgtgaacctgctgtatggcggcaaacgtatcaacaaactgtcgatctgaggctggggtaagttatgtttcaaatcctaaaagcagac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cttatgttttaccgcgattgtgggtacacgtttgtatcgtgaacctgctgtatggcggcaaacgtatcaacaaactgtcgatc | |||
| Protein-Sequence | |||
| PYVLPRLWVHVCIVNLLYGGKRINKLSI | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 288349 to: 288438 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438336 to: 438425 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756343 to: 756432 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1798 to: 1848 | |||
| gi-nr: gi|28875437 gi_def: Uncultured bacterium plasmid pAK116 YaaU (yaaU) gene, partial cds; and Orf23, YabF (yabF), and SecF (secF) genes, complete cds hsp_num: 1 from: 1826 to: 1879 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 2887 to: 2940 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2553029 to: 2553082 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171229 to: 1171282 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2845922 to: 2845975 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511171 to: 3511224 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197244 to: 3197297 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436420 to: 3436473 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550289 to: 3550342 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805183 to: 805236 | |||
| gi-nr: gi|109693602 gi_def: Synthetic construct Yersinia pestis clone FLH0149330.01X secF gene, complete sequence hsp_num: 1 from: 6 to: 59 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982679 to: 2982732 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052568 to: 1052621 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125428 to: 1125481 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1125140 to: 1125193 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276332 to: 1276385 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1798 to: 1848 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1798 to: 1848 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 13502 to: 13555 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 205333 to: 205386 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 2408866 to: 2408919 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 2524714 to: 2524767 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 508620 to: 508673 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1111186 to: 1111242 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 462319 to: 462372 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 493236 to: 493289 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 402178 to: 402231 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 978850 to: 978903 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 445416 to: 445469 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 393041 to: 393094 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 496934 to: 496987 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 443827 to: 443880 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 358942 to: 358995 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 428668 to: 428721 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 428668 to: 428721 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 503635 to: 503688 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 358077 to: 358130 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 493073 to: 493126 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 493075 to: 493128 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 8894 to: 8947 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 314412 to: 314465 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 318415 to: 318468 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 414538 to: 414591 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 55969 to: 56022 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 1798 to: 1848 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1083 to: 1133 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503371 to: 1503424 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 482 to: 535 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268864 to: 1268917 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_026|beg|474|length|117|forward|gi | ||
| Query_DNA-Sequence | |||
| gacgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttc | |||
| Protein-Sequence | |||
| RFSMSLISVAHAAGEGAPQGGGFEMIIMLAMFAVIFYF | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205958 to: 2206053 | |||
Coding-DNA |
|||
| acgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttc | |||
| Protein-Sequence | |||
| RFSMSLISVAHAAGEGAPQGGGFEMIIMLAMFAVIFYF | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205958 to: 2206053 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_029|beg|1466|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| ttttgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactagccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cgaagctcgcttacaggaaattcgcaactagccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggt | |||
| Protein-Sequence | |||
| YRSSLTGNSQLAVEQNITILRNRVNELG | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755224 to: 755274 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439494 to: 439544 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130114 to: 130164 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057962 to: 1058012 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617622 to: 617672 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204942 to: 2204992 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170101 to: 1170157 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512296 to: 3512352 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198369 to: 3198425 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803460 to: 2803510 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729445 to: 2729495 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437545 to: 3437601 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901769 to: 1901819 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551414 to: 3551470 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804055 to: 804111 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 670 to: 726 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983804 to: 2983860 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051440 to: 1051496 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124300 to: 1124356 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124012 to: 1124068 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57094 to: 57144 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695140 to: 2695196 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145376 to: 1145432 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285168 to: 2285218 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233705 to: 233755 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232430 to: 232480 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765961 to: 2766011 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853470 to: 1853523 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110064 to: 1110114 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172561 to: 2172617 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461191 to: 461247 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492108 to: 492164 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444288 to: 444344 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391913 to: 391969 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495806 to: 495862 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442699 to: 442755 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357814 to: 357870 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427540 to: 427596 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427540 to: 427596 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502507 to: 502563 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1759 to: 1815 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356949 to: 357005 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275204 to: 1275260 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491945 to: 492001 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491947 to: 492003 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7766 to: 7822 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315537 to: 315593 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317287 to: 317343 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413410 to: 413466 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362806 to: 3362856 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40463 to: 40513 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274810 to: 3274860 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240596 to: 1240646 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940417 to: 940467 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073435 to: 1073485 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514484 to: 1514534 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637418 to: 637468 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990495 to: 2990545 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882227 to: 2882277 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 2 from: 793792 to: 793842 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 2 from: 580022 to: 580072 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732181 to: 1732231 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666479 to: 1666529 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245301 to: 3245351 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683135 to: 1683185 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611707 to: 1611757 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446590 to: 1446640 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59295 to: 59345 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578071 to: 578121 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240609 to: 3240659 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6685 to: 6741 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371567 to: 3371617 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 3202747 to: 3202797 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612240 to: 2612290 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080813 to: 3080863 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050258 to: 3050308 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2477 to: 2527 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2316 to: 2366 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101744 to: 2101794 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417577 to: 1417627 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190651 to: 190701 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632467 to: 2632517 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12223 to: 12273 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_032|beg|800|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| acgctgaaatctcttttaaaacagccataggatcctcTgctgtgctaaaccgttatccggttatggaagtatctgatggtgatgttaaccatTcgccgttgcagccttgtatgcaTcttcca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_034|beg|2422|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| gcgtatttcgtgaagagctacgcgaaggTaaaaaatcccgagcaagcgattcatcaaggttacTgctaacgcattcagtaccattgccgtgccaacatcaccaTccttaattacggcgatcaTtttttgtttgccgttgg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_036|beg|274|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| aaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcggtgcactgggttggat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg | |||
| Protein-Sequence | |||
| SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341 | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672 | |||
| gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595 | |||
Coding-DNA |
|||
| aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg | |||
| Protein-Sequence | |||
| SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341 | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672 | |||
| gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595 | |||
Coding-DNA |
|||
| aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg | |||
| Protein-Sequence | |||
| SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341 | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672 | |||
| gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_037|beg|10|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgtgcgtcTgtggtatcgacatgtttgactgtgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgatcaagatccgtaatgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgat | |||
| Protein-Sequence | |||
| LCMPTRNARNGHLFVTGWCD | |||
| Hit-Information Section | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 1 from: 805 to: 849 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 285755 to: 285799 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 795045 to: 795089 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056417 to: 1056461 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753739 to: 753783 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616092 to: 616136 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206489 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128718 to: 128762 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440985 to: 441029 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58553 to: 58594 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 799 to: 840 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1013 to: 1054 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1014 to: 1055 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108373 to: 2108426 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315906 to: 315947 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393714 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156833 to: 1156874 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554302 to: 1554343 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335010 to: 335051 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728424 to: 728465 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271897 to: 271938 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352379 to: 352420 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202824 to: 202865 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6385 to: 6426 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10993 to: 11034 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335514 to: 335555 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139952 to: 139993 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831882 to: 831923 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505990 to: 1506031 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117106 to: 1117147 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627103 to: 627144 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681751 to: 1681792 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610323 to: 1610364 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3859 to: 3900 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139462 to: 139503 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3663 to: 3701 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2948 to: 2986 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 63 to: 101 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9826 to: 9864 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3664 to: 3702 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3056 to: 3094 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688262 to: 688297 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712916 to: 712951 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267340 to: 267381 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4169 to: 4210 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168714 to: 1168755 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555550 to: 2555591 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459810 to: 459851 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490727 to: 490768 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848442 to: 2848483 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513781 to: 3513822 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399670 to: 399711 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976342 to: 976383 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199854 to: 3199895 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439040 to: 3439081 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442907 to: 442948 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552899 to: 3552940 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802585 to: 802626 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390532 to: 390573 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494425 to: 494466 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478495 to: 1478536 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985289 to: 2985330 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049970 to: 1050011 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122830 to: 1122871 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441318 to: 441359 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356433 to: 356474 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108678 to: 1108719 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426159 to: 426200 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426159 to: 426200 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501126 to: 501167 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355568 to: 355609 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122542 to: 1122583 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273718 to: 1273759 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490564 to: 490605 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411387 to: 2411428 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527235 to: 2527276 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506111 to: 506152 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490566 to: 490607 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316933 to: 316974 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412029 to: 412070 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 158 | |||
| gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 35 to: 70 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939495 to: 939536 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300034 to: 300069 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749934 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693151 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867707 to: 1867742 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295841 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496021 to: 3496062 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804894 to: 2804935 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697011 to: 2697052 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900345 to: 1900386 | |||
| gi-nr: gi|83596024 gi_def: Uncultured marine bacterium Ant39E11, partial genomic sequence hsp_num: 1 from: 4568 to: 4609 | |||
| gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14056 to: 14091 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899100 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244920 to: 244955 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307010 to: 1307048 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985608 to: 985646 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879338 to: 3879376 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375542 to: 3375583 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246777 to: 1246815 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279677 to: 4279715 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054205 to: 1054243 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696599 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143635 to: 1143673 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579574 to: 579615 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970942 to: 970980 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178858 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65671 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59627 to: 59662 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48780 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551089 to: 551127 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219819 to: 5219857 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726389 to: 5726427 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553850 to: 1553888 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448226 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665927 to: 665962 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364199 to: 3364240 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883621 to: 2883662 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730861 to: 2730902 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276203 to: 3276244 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730796 to: 1730837 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651627 to: 2651668 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246693 to: 3246734 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634601 to: 1634642 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280973 to: 3281008 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949332 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481776 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822760 to: 1822795 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512640 to: 1512675 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529920 to: 3529955 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387225 to: 1387260 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339970 to: 340005 | |||
Coding-DNA |
|||
| tgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgat | |||
| Protein-Sequence | |||
| LCMPTRNARNGHLFVTGWCD | |||
| Hit-Information Section | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 1 from: 805 to: 849 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 285755 to: 285799 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 795045 to: 795089 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056417 to: 1056461 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753739 to: 753783 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616092 to: 616136 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206489 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128718 to: 128762 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440985 to: 441029 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58553 to: 58594 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 799 to: 840 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1013 to: 1054 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1014 to: 1055 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108373 to: 2108426 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315906 to: 315947 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393714 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156833 to: 1156874 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554302 to: 1554343 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335010 to: 335051 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728424 to: 728465 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271897 to: 271938 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352379 to: 352420 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202824 to: 202865 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6385 to: 6426 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10993 to: 11034 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335514 to: 335555 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139952 to: 139993 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831882 to: 831923 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505990 to: 1506031 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117106 to: 1117147 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627103 to: 627144 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681751 to: 1681792 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610323 to: 1610364 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3859 to: 3900 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139462 to: 139503 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3663 to: 3701 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2948 to: 2986 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 63 to: 101 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9826 to: 9864 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3664 to: 3702 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3056 to: 3094 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688262 to: 688297 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712916 to: 712951 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267340 to: 267381 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4169 to: 4210 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168714 to: 1168755 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555550 to: 2555591 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459810 to: 459851 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490727 to: 490768 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848442 to: 2848483 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513781 to: 3513822 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399670 to: 399711 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976342 to: 976383 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199854 to: 3199895 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439040 to: 3439081 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442907 to: 442948 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552899 to: 3552940 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802585 to: 802626 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390532 to: 390573 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494425 to: 494466 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478495 to: 1478536 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985289 to: 2985330 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049970 to: 1050011 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122830 to: 1122871 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441318 to: 441359 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356433 to: 356474 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108678 to: 1108719 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426159 to: 426200 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426159 to: 426200 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501126 to: 501167 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355568 to: 355609 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122542 to: 1122583 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273718 to: 1273759 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490564 to: 490605 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411387 to: 2411428 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527235 to: 2527276 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506111 to: 506152 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490566 to: 490607 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316933 to: 316974 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412029 to: 412070 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 158 | |||
| gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 35 to: 70 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939495 to: 939536 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300034 to: 300069 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749934 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693151 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867707 to: 1867742 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295841 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496021 to: 3496062 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804894 to: 2804935 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697011 to: 2697052 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900345 to: 1900386 | |||
| gi-nr: gi|83596024 gi_def: Uncultured marine bacterium Ant39E11, partial genomic sequence hsp_num: 1 from: 4568 to: 4609 | |||
| gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14056 to: 14091 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899100 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244920 to: 244955 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307010 to: 1307048 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985608 to: 985646 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879338 to: 3879376 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375542 to: 3375583 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246777 to: 1246815 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279677 to: 4279715 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054205 to: 1054243 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696599 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143635 to: 1143673 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579574 to: 579615 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970942 to: 970980 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178858 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65671 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59627 to: 59662 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48780 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551089 to: 551127 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219819 to: 5219857 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726389 to: 5726427 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553850 to: 1553888 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448226 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665927 to: 665962 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364199 to: 3364240 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883621 to: 2883662 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730861 to: 2730902 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276203 to: 3276244 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730796 to: 1730837 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651627 to: 2651668 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246693 to: 3246734 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634601 to: 1634642 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280973 to: 3281008 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949332 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481776 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822760 to: 1822795 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512640 to: 1512675 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529920 to: 3529955 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387225 to: 1387260 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339970 to: 340005 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_040|beg|1586|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| gttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttgccgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttg | |||
| Protein-Sequence | |||
| FNRQGATRIVVELPGVQDTARAKEILGATATLVIFVKWTIKPTC | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 848 to: 874 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 796686 to: 796712 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287396 to: 287422 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287302 to: 287391 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058034 to: 1058123 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755296 to: 755385 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617694 to: 617783 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439383 to: 439472 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204831 to: 2204920 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130186 to: 130275 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504388 to: 1504477 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2097 to: 2186 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554043 to: 2554132 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461269 to: 461358 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492186 to: 492275 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332605 to: 332694 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846936 to: 2847025 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153855 to: 1153944 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726019 to: 726108 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354736 to: 354825 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444366 to: 444455 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391991 to: 392080 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495884 to: 495973 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442777 to: 442866 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357892 to: 357981 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556675 to: 1556764 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110136 to: 1110225 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427618 to: 427707 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427618 to: 427707 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12452 to: 12541 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502585 to: 502674 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1837 to: 1926 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357027 to: 357116 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275282 to: 1275371 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56983 to: 57072 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204283 to: 204372 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492023 to: 492112 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409880 to: 2409969 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525728 to: 2525817 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507570 to: 507659 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269492 to: 269581 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492025 to: 492114 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7844 to: 7933 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315426 to: 315515 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317365 to: 317454 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413488 to: 413577 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401128 to: 401217 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235596 to: 1235685 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285057 to: 2285146 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463699 to: 1463788 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170179 to: 1170268 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512185 to: 3512274 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977800 to: 977889 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198258 to: 3198347 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437434 to: 3437523 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551303 to: 3551392 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804133 to: 804222 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983693 to: 2983782 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051518 to: 1051607 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124378 to: 1124467 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124090 to: 1124179 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803349 to: 2803438 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901841 to: 1901930 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336987 to: 337076 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362695 to: 3362784 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882116 to: 2882205 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274699 to: 3274788 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732253 to: 1732342 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650119 to: 2650208 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666551 to: 1666640 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245190 to: 3245279 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683207 to: 1683296 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611779 to: 1611868 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636059 to: 1636148 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240498 to: 3240587 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695400 to: 2695489 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420005 to: 1420094 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494505 to: 3494594 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987132 to: 987221 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729334 to: 2729423 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724804 to: 5724893 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972466 to: 972555 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695029 to: 2695118 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714443 to: 714532 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308534 to: 1308623 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1248301 to: 1248390 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4278102 to: 4278191 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1055729 to: 1055818 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 2 from: 1514178 to: 1514267 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279397 to: 3279486 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267820 to: 1267909 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446479 to: 1446568 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531418 to: 3531513 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940306 to: 940395 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1869300 to: 1869389 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172639 to: 2172734 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853359 to: 1853448 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628555 to: 628644 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164646 to: 3164735 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621723 to: 1621812 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877760 to: 3877849 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533785 to: 533880 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1358 to: 1447 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8236 to: 8325 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1466 to: 1555 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218239 to: 5218328 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241200 to: 2241289 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317786 to: 4317881 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218659 to: 2218748 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245166 to: 2245255 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388763 to: 1388852 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555387 to: 1555476 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990384 to: 2990473 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301623 to: 301718 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371639 to: 3371728 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080885 to: 3080974 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233777 to: 233866 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232502 to: 232591 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169633 to: 5169728 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480006 to: 1480095 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59184 to: 59273 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261551 to: 4261646 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968881 to: 968976 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140901 to: 4140990 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928798 to: 4928887 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40535 to: 40624 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597476 to: 4597565 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765844 to: 2765933 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921378 to: 2921467 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44908 to: 44997 | |||
Coding-DNA |
|||
| ttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttg | |||
| Protein-Sequence | |||
| FNRQGATRIVVELPGVQDTARAKEILGATATLVIFVKWTIKPTC | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 848 to: 874 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 796686 to: 796712 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287396 to: 287422 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287302 to: 287391 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058034 to: 1058123 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755296 to: 755385 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617694 to: 617783 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439383 to: 439472 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204831 to: 2204920 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130186 to: 130275 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504388 to: 1504477 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2097 to: 2186 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554043 to: 2554132 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461269 to: 461358 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492186 to: 492275 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332605 to: 332694 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846936 to: 2847025 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153855 to: 1153944 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726019 to: 726108 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354736 to: 354825 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444366 to: 444455 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391991 to: 392080 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495884 to: 495973 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442777 to: 442866 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357892 to: 357981 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556675 to: 1556764 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110136 to: 1110225 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427618 to: 427707 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427618 to: 427707 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12452 to: 12541 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502585 to: 502674 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1837 to: 1926 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357027 to: 357116 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275282 to: 1275371 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56983 to: 57072 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204283 to: 204372 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492023 to: 492112 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409880 to: 2409969 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525728 to: 2525817 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507570 to: 507659 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269492 to: 269581 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492025 to: 492114 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7844 to: 7933 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315426 to: 315515 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317365 to: 317454 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413488 to: 413577 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401128 to: 401217 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235596 to: 1235685 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285057 to: 2285146 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463699 to: 1463788 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170179 to: 1170268 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512185 to: 3512274 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977800 to: 977889 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198258 to: 3198347 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437434 to: 3437523 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551303 to: 3551392 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804133 to: 804222 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983693 to: 2983782 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051518 to: 1051607 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124378 to: 1124467 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124090 to: 1124179 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 748 to: 837 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803349 to: 2803438 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901841 to: 1901930 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336987 to: 337076 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362695 to: 3362784 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882116 to: 2882205 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274699 to: 3274788 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732253 to: 1732342 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650119 to: 2650208 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666551 to: 1666640 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245190 to: 3245279 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683207 to: 1683296 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611779 to: 1611868 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636059 to: 1636148 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240498 to: 3240587 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695400 to: 2695489 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420005 to: 1420094 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494505 to: 3494594 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987132 to: 987221 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729334 to: 2729423 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724804 to: 5724893 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972466 to: 972555 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695029 to: 2695118 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714443 to: 714532 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308534 to: 1308623 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1248301 to: 1248390 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4278102 to: 4278191 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1055729 to: 1055818 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 2 from: 1514178 to: 1514267 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279397 to: 3279486 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267820 to: 1267909 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446479 to: 1446568 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531418 to: 3531513 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940306 to: 940395 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1869300 to: 1869389 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172639 to: 2172734 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853359 to: 1853448 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628555 to: 628644 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164646 to: 3164735 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621723 to: 1621812 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877760 to: 3877849 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533785 to: 533880 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1358 to: 1447 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8236 to: 8325 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1466 to: 1555 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218239 to: 5218328 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241200 to: 2241289 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317786 to: 4317881 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218659 to: 2218748 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245166 to: 2245255 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388763 to: 1388852 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555387 to: 1555476 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990384 to: 2990473 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301623 to: 301718 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371639 to: 3371728 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080885 to: 3080974 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233777 to: 233866 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232502 to: 232591 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169633 to: 5169728 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480006 to: 1480095 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59184 to: 59273 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261551 to: 4261646 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968881 to: 968976 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140901 to: 4140990 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928798 to: 4928887 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40535 to: 40624 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597476 to: 4597565 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765844 to: 2765933 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921378 to: 2921467 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44908 to: 44997 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_048|beg|334|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| cgTcgtcgtaaccgcgaagtgccaccTactTacaaaaagacaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattcacccctgtgcatcccc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_051|beg|645|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| cgatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagTatttgctgaagataacTgcttacatcacaaatcgagttgaacaccaacaacgaag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaag | |||
| Protein-Sequence | |||
| MAKGDEVLTSGGLVGRITK | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057086 to: 1057142 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 749604 to: 749660 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542045 to: 2542101 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283943 to: 3283999 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267955 to: 3268011 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234649 to: 1234705 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1190351 to: 1190407 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 301341 to: 301397 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 802636 to: 802692 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 683955 to: 684011 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 253460 to: 253516 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 705405 to: 705461 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2490658 to: 2490714 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3694008 to: 3694064 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616746 to: 616802 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3435206 to: 3435262 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1426821 to: 1426877 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462754 to: 1462810 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555018 to: 2555074 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460327 to: 460383 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491244 to: 491300 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847911 to: 2847967 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400187 to: 400243 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976859 to: 976915 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443424 to: 443480 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391049 to: 391105 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494942 to: 494998 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441835 to: 441891 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356950 to: 357006 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426676 to: 426732 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426676 to: 426732 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11510 to: 11566 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501643 to: 501699 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 477 to: 533 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 895 to: 951 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356085 to: 356141 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203341 to: 203397 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491081 to: 491137 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410855 to: 2410911 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526703 to: 2526759 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506628 to: 506684 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491083 to: 491139 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6902 to: 6958 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316401 to: 316457 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316423 to: 316479 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412546 to: 412602 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1530 to: 1586 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1531 to: 1587 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205844 to: 2205900 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804324 to: 2804380 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336041 to: 336097 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274340 to: 1274396 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555724 to: 1555780 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129237 to: 129293 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900899 to: 1900955 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109194 to: 1109250 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635118 to: 1635174 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534808 to: 534864 | |||
Coding-DNA |
|||
| gatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaag | |||
| Protein-Sequence | |||
| MAKGDEVLTSGGLVGRITK | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057086 to: 1057142 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 749604 to: 749660 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542045 to: 2542101 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283943 to: 3283999 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267955 to: 3268011 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234649 to: 1234705 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1190351 to: 1190407 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 301341 to: 301397 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 802636 to: 802692 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 683955 to: 684011 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 253460 to: 253516 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 705405 to: 705461 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2490658 to: 2490714 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3694008 to: 3694064 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616746 to: 616802 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3435206 to: 3435262 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1426821 to: 1426877 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462754 to: 1462810 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555018 to: 2555074 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460327 to: 460383 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491244 to: 491300 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847911 to: 2847967 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400187 to: 400243 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976859 to: 976915 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443424 to: 443480 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391049 to: 391105 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494942 to: 494998 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441835 to: 441891 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356950 to: 357006 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426676 to: 426732 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426676 to: 426732 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11510 to: 11566 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501643 to: 501699 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 477 to: 533 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 895 to: 951 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356085 to: 356141 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203341 to: 203397 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491081 to: 491137 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410855 to: 2410911 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526703 to: 2526759 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506628 to: 506684 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491083 to: 491139 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6902 to: 6958 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316401 to: 316457 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316423 to: 316479 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412546 to: 412602 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1530 to: 1586 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1531 to: 1587 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205844 to: 2205900 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804324 to: 2804380 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336041 to: 336097 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274340 to: 1274396 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555724 to: 1555780 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129237 to: 129293 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900899 to: 1900955 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109194 to: 1109250 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635118 to: 1635174 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534808 to: 534864 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_053|beg|1619|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| gagcttgccgggtgtacaagTatacagcgcgtgctaagaaatcttaggcgTcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttgccg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_054|beg|1516|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| ctacgccTgttgagcagaacatcatattttgcgtaaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtacgtggtagagctgccgggtgtacaagatac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tacgccTgttgagcagaacatcatattttgcgtaaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtacgtggtag | |||
| Protein-Sequence | |||
| TPVEQNIIFCVNRVNELGVAEPLVQRQGATRTW*S | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130203 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57055 to: 57141 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617711 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204903 to: 2204989 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145462 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44980 to: 45066 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_057|beg|271|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| tggaaagcattcgtaaagcatttgatgaagaccgttttgaccaatttgtTagccgagttctacgcgcgtTcgtaaccgcgaagtgccaccactacaaaaagacaaagcctgattt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggaaagcattcgtaaagcatttgatgaagaccgttttgaccaatttgtTagccgagttctacgcgcgtTcgtaaccgcgaagtgccaccactacaa | |||
| Protein-Sequence | |||
| ESIRKAFDEDRFDQFVSRVLRAFVTAKCHHYK | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616320 to: 616367 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753967 to: 754014 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 3 from: 440754 to: 440801 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056645 to: 1056695 | |||
Coding-DNA |
|||
| ggaaagcattcgtaaagcatttgatgaagaccgttttgaccaatttgtTagccgagttctacgcgcgtTcgtaaccgcgaagtgccaccactacaa | |||
| Protein-Sequence | |||
| ESIRKAFDEDRFDQFVSRVLRAFVTAKCHHYK | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616320 to: 616367 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753967 to: 754014 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 3 from: 440754 to: 440801 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056645 to: 1056695 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_058|beg|1835|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| tcaaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgatTagcgaaggcggcaacaagatgtcagcgttctcgaaaaagaacattggcTaagTctgatggcgacggtgtttgccga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgat | |||
| Protein-Sequence | |||
| QSADEYGRPQVNISLD | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058280 to: 1058324 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617940 to: 617984 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755542 to: 755586 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439182 to: 439226 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204630 to: 2204674 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130432 to: 130476 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480252 to: 1480296 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401374 to: 401418 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902093 to: 1902131 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803148 to: 2803186 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145706 to: 1145744 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978052 to: 978090 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284856 to: 2284894 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110382 to: 1110426 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275528 to: 1275572 | |||
Coding-DNA |
|||
| caaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgat | |||
| Protein-Sequence | |||
| QSADEYGRPQVNISLD | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058280 to: 1058324 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617940 to: 617984 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755542 to: 755586 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439182 to: 439226 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204630 to: 2204674 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130432 to: 130476 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480252 to: 1480296 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401374 to: 401418 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902093 to: 1902131 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803148 to: 2803186 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145706 to: 1145744 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978052 to: 978090 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284856 to: 2284894 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110382 to: 1110426 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275528 to: 1275572 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_059|beg|2348|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcg | |||
| Protein-Sequence | |||
| MTLPGIAGIVLTVGMAVRCQRTDFRAYS | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 10 from: 1510 to: 1560 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 9 from: 288058 to: 288108 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 9 from: 797348 to: 797398 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058790 to: 1058840 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 3 from: 1514940 to: 1514990 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 337746 to: 337796 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 5 from: 1439105 to: 1439155 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1246504 to: 1246554 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 4 from: 1683960 to: 1684010 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 1902597 to: 1902647 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 5 from: 2889163 to: 2889213 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756052 to: 756102 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438666 to: 438716 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1184142 to: 1184192 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1612532 to: 1612582 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 2728620 to: 2728670 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 3 from: 1636812 to: 1636862 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204114 to: 2204164 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 960095 to: 960145 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 3 from: 5217513 to: 5217563 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 3 from: 3810359 to: 3810409 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 4 from: 3273985 to: 3274035 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 3 from: 1146210 to: 1146260 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 3 from: 1333311 to: 1333361 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540242 to: 1540292 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 3 from: 4143524 to: 4143574 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 4 from: 3493791 to: 3493841 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 3 from: 1072604 to: 1072654 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1504 to: 1554 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 1351 to: 1401 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 635 to: 685 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 3 from: 7513 to: 7563 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 3 from: 743 to: 793 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4596774 to: 4596824 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553510 to: 553560 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 188 to: 238 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618450 to: 618500 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130942 to: 130992 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217146 to: 1217196 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084354 to: 1084404 | |||
| gi-nr: gi|34398108 gi_def: Porphyromonas gingivalis W83, complete genome hsp_num: 1 from: 1849643 to: 1849693 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621003 to: 1621053 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939583 to: 939633 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802632 to: 2802682 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804543 to: 1804593 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41288 to: 41338 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852639 to: 1852689 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268570 to: 1268620 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694683 to: 2694733 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420770 to: 1420820 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445756 to: 1445806 | |||
| gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 2434534 to: 2434584 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069431 to: 1069481 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824763 to: 1824813 | |||
| gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 2456349 to: 2456399 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694309 to: 2694359 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240480 to: 2240530 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 58464 to: 58514 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217939 to: 2217989 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244446 to: 2244496 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3923135 to: 3923185 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 3361981 to: 3362031 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 3305656 to: 3305706 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 2881402 to: 2881452 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1204808 to: 1204858 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1733006 to: 1733056 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3000836 to: 3000886 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 2649405 to: 2649455 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1191750 to: 1191800 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1667304 to: 1667354 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237429 to: 3237479 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125311 to: 1125361 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13024 to: 13074 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7492 to: 7542 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922685 to: 1922735 | |||
| gi-nr: gi|17739985 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 140 of 256 of the complete sequence hsp_num: 1 from: 4097 to: 4147 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1549425 to: 1549475 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 1049215 to: 1049265 | |||
| gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2261419 to: 2261469 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356854 to: 356904 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 961118 to: 961168 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896539 to: 896589 | |||
| gi-nr: gi|83755449 gi_def: Salinibacter ruber DSM 13855, complete genome hsp_num: 1 from: 2262676 to: 2262726 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 1351 to: 1401 | |||
| gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591906 to: 591956 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709727 to: 1709777 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 692441 to: 692491 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 631931 to: 631981 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1577224 to: 1577274 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996502 to: 1996552 | |||
| gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2076514 to: 2076564 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 1145496 to: 1145546 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244476 to: 3244526 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 1495 to: 1545 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 5064020 to: 5064070 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 3 from: 1480762 to: 1480812 | |||
| gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1334559 to: 1334609 | |||
| gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282820 to: 1282870 | |||
| gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 1 from: 233350 to: 233400 | |||
| gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144066 to: 144116 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 1237504 to: 1237554 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 3239784 to: 3239834 | |||
| gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 797603 to: 797653 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284343 to: 2284393 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435445 to: 435495 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492838 to: 1492888 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309296 to: 1309346 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989673 to: 2989723 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987891 to: 987941 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44763 to: 44813 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877037 to: 3877087 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278674 to: 3278724 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377908 to: 3377958 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249063 to: 1249113 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277379 to: 4277429 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056488 to: 1056538 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165396 to: 3165446 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650997 to: 1651047 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695378 to: 2695428 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724081 to: 5724131 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577195 to: 577245 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156396 to: 156446 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131803 to: 2131853 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973225 to: 973275 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575536 to: 1575586 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389525 to: 1389575 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556149 to: 1556199 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401486 to: 401536 | |||
| gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 2 from: 244260 to: 244310 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560720 to: 1560770 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598095 to: 1598145 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629576 to: 1629626 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208239 to: 1208289 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777355 to: 4777405 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268972 to: 1269022 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618818 to: 4618868 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224508 to: 4224558 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 2859094 to: 2859144 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257004 to: 3257054 | |||
| gi-nr: gi|110279108 gi_def: Cytophaga hutchinsonii ATCC 33406, complete genome hsp_num: 1 from: 138931 to: 138981 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62992 to: 63042 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001432 to: 2001482 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 777465 to: 777515 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013800 to: 3013850 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869515 to: 1869565 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745366 to: 745416 | |||
| gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8414 to: 8464 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939503 to: 1939553 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017510 to: 1017560 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549800 to: 549850 | |||
| gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1210 to: 1260 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65066 to: 65116 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243439 to: 5243489 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78949 to: 78999 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 2169217 to: 2169267 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043525 to: 1043575 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572037 to: 572087 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452919 to: 452969 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462319 to: 462369 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029139 to: 1029189 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534153 to: 1534203 | |||
| gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553815 to: 2553865 | |||
| gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521365 to: 2521415 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026554 to: 1026604 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094545 to: 3094595 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152903 to: 1152953 | |||
| gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 28197 to: 28247 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384711 to: 384761 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056534 to: 2056584 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115866 to: 3115916 | |||
| gi-nr: gi|24204616 gi_def: Leptospira interrogans serovar lai str. 56601 chromosome I, complete sequence hsp_num: 1 from: 1148354 to: 1148404 | |||
| gi-nr: gi|45602555 gi_def: Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130, chromosome I, complete sequence hsp_num: 1 from: 3077024 to: 3077074 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1252531 to: 1252581 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 200328 to: 200378 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081154 to: 1081204 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1384185 to: 1384235 | |||
| gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 156006 to: 156056 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920571 to: 1920621 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209281 to: 209331 | |||
| gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 909105 to: 909155 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496627 to: 1496677 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13811 to: 13861 | |||
| gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 33907 to: 33957 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734846 to: 734896 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207085 to: 2207135 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10426 to: 10476 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841222 to: 1841272 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71993 to: 72043 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869379 to: 2869429 | |||
| gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1432636 to: 1432686 | |||
| gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1418858 to: 1418908 | |||
| gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1454867 to: 1454917 | |||
| gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1540 to: 1590 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715199 to: 715249 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045599 to: 1045649 | |||
| gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2814599 to: 2814649 | |||
| gi-nr: gi|146152184 gi_def: Flavobacterium johnsoniae UW101, complete genome hsp_num: 2 from: 2720612 to: 2720662 | |||
| gi-nr: gi|57236801 gi_def: Flavobacterium johnsoniae Mdh (mdh) gene, partial cds; SecDF (secDF) gene, complete cds; and hypothetical protein (fjo28) gene, partial cds hsp_num: 2 from: 2239 to: 2289 | |||
| gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 1 from: 643098 to: 643148 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162605 to: 1162655 | |||
| gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 2187206 to: 2187256 | |||
| gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359107 to: 1359157 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611214 to: 1611264 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503668 to: 1503718 | |||
| gi-nr: gi|94554390 gi_def: Deinococcus geothermalis DSM 11300, complete genome hsp_num: 1 from: 1319033 to: 1319083 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244279 to: 1244329 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1729437 to: 1729487 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1129613 to: 1129663 | |||
| gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64749 to: 64799 | |||
| gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44809 to: 44859 | |||
| gi-nr: gi|11612676 gi_def: Deinococcus radiodurans R1 chromosome 1, complete sequence hsp_num: 1 from: 1847884 to: 1847934 | |||
| gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 1255293 to: 1255343 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236349 to: 1236399 | |||
| gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 1115684 to: 1115734 | |||
| gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 1239593 to: 1239643 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557434 to: 1557484 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834673 to: 1834723 | |||
| gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 743822 to: 743872 | |||
| gi-nr: gi|33634491 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 2/7 hsp_num: 1 from: 322073 to: 322123 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401946 to: 2401996 | |||
| gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 4365264 to: 4365314 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122499 to: 122549 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833414 to: 833464 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241379 to: 1241429 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 1602595 to: 1602645 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1066137 to: 1066187 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636757 to: 1636807 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515267 to: 1515317 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5879053 to: 5879103 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804384 to: 1804434 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2213065 to: 2213115 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883605 to: 1883655 | |||
| gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660974 to: 661024 | |||
| gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331519 to: 331569 | |||
| gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 1109995 to: 1110045 | |||
| gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4537 to: 4587 | |||
Coding-DNA |
|||
| atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcgtgaag | |||
| Protein-Sequence | |||
| ALHEYARKSVRWHRTAIPTVNTIPAIPGKV | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1058792 to: 1058839 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514942 to: 1514989 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337748 to: 337795 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683962 to: 1684009 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 5 from: 1246506 to: 1246553 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 756054 to: 756101 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 3 from: 438667 to: 438714 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612534 to: 1612581 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728621 to: 2728668 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636814 to: 1636861 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204115 to: 2204162 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217514 to: 5217561 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273986 to: 3274033 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3810360 to: 3810407 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1146212 to: 1146259 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333312 to: 1333359 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 2 from: 1540244 to: 1540291 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493792 to: 3493839 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4143525 to: 4143572 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072605 to: 1072652 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1352 to: 1399 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 636 to: 683 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7514 to: 7561 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 744 to: 791 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596775 to: 4596822 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 190 to: 237 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618452 to: 618499 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130944 to: 130991 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217147 to: 1217194 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084355 to: 1084402 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1621004 to: 1621051 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 939584 to: 939631 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 41290 to: 41337 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 1852640 to: 1852687 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1268572 to: 1268619 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694684 to: 2694731 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 2 from: 1420772 to: 1420819 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 1445757 to: 1445804 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 2 from: 1069433 to: 1069480 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824765 to: 1824812 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2694310 to: 2694357 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2240481 to: 2240528 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58465 to: 58512 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2217940 to: 2217987 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2244447 to: 2244494 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361982 to: 3362029 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 4 from: 3923136 to: 3923183 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881403 to: 2881450 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 4 from: 3305657 to: 3305704 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733008 to: 1733055 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 4 from: 1204810 to: 1204857 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649406 to: 2649453 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667306 to: 1667353 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 4 from: 1191752 to: 1191799 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125312 to: 1125359 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 2 from: 13026 to: 13073 | |||
| gi-nr: gi|17739985 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 140 of 256 of the complete sequence hsp_num: 2 from: 4098 to: 4145 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 1549426 to: 1549473 | |||
| gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 2 from: 1049217 to: 1049264 | |||
| gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 4420636 to: 4420683 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692442 to: 692489 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631932 to: 631979 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 3 from: 3244477 to: 3244524 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145498 to: 1145545 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1497 to: 1544 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480770 to: 1480811 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239785 to: 3239832 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 4 from: 1237506 to: 1237553 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284344 to: 2284391 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 2 from: 435446 to: 435493 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492839 to: 1492886 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2989674 to: 2989721 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44764 to: 44811 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278675 to: 3278722 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377910 to: 3377957 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650998 to: 1651045 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156397 to: 156444 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 2 from: 2131804 to: 2131851 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575538 to: 1575585 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389527 to: 1389574 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556151 to: 1556198 | |||
| gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244262 to: 244309 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560721 to: 1560768 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598097 to: 1598144 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629577 to: 1629624 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618819 to: 4618866 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224509 to: 4224556 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 2 from: 2859095 to: 2859142 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 2 from: 78950 to: 78997 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169219 to: 2169266 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043526 to: 1043573 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572039 to: 572086 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029140 to: 1029187 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026555 to: 1026602 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152904 to: 1152951 | |||
| gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 3 from: 668427 to: 668459 | |||
| gi-nr: gi|146152184 gi_def: Flavobacterium johnsoniae UW101, complete genome hsp_num: 1 from: 2720614 to: 2720661 | |||
| gi-nr: gi|57236801 gi_def: Flavobacterium johnsoniae Mdh (mdh) gene, partial cds; SecDF (secDF) gene, complete cds; and hypothetical protein (fjo28) gene, partial cds hsp_num: 1 from: 2241 to: 2288 | |||
| gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 2 from: 643100 to: 643147 | |||
| gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 3 from: 1309713 to: 1309754 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 2 from: 1129614 to: 1129661 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_060|beg|2663|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| ggcaaacgtatcaacaaactgtcTgatctgaggctggggtaagttatgtttcaaatcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcccttcgccttgtcgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc | |||
| Protein-Sequence | |||
| MFQILKADKMIDFMRWSKFA | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438298 to: 438378 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756390 to: 756470 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131298 to: 131357 | |||
Coding-DNA |
|||
| atcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc | |||
| Protein-Sequence | |||
| MFQILKADKMIDFMRWSKFA | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438298 to: 438378 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756390 to: 756470 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131298 to: 131357 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_061|beg|697|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| ccacaagTattgctgaagataacgcttacTatcacaatcgaagttgaacaccaacaacgaagttgtgtcaagaaggaTcttcgtgactgcagtgctaccaaaaTggta | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_062|beg|2459|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| cagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaTccaccttaattacggcgatcattttgtttgccgttggtacaggggcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaTccaccttaattacggcgatcattttgtttgccgttggtacaggggcg | |||
| Protein-Sequence | |||
| QQAIHQGYANAFSTIADANIIHLNYGDHFVCRWYRG | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756163 to: 756231 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618561 to: 618629 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438605 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204053 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 299 to: 367 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131053 to: 131121 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361861 to: 3361920 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273865 to: 3273924 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667415 to: 1667474 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684071 to: 1684130 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733117 to: 1733176 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612643 to: 1612702 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881282 to: 2881341 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493671 to: 3493730 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244356 to: 3244415 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728500 to: 2728559 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694563 to: 2694622 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636923 to: 1636982 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649285 to: 2649344 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239664 to: 3239723 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480873 to: 1480932 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629469 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_063|beg|1638|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| atacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaatcaagttcgatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaa | |||
| Protein-Sequence | |||
| *FRCHRRTSCCRSGKGRLYRPLHENSRVAVAPKIFFSTRC | |||
| Hit-Information Section | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5745202 to: 5745270 | |||
| gi-nr: gi|66934576 gi_def: Pseudomonas viridiflava strain RMX23.1a pectate lyase gene, complete cds hsp_num: 1 from: 707 to: 742 | |||
| gi-nr: gi|46125758 gi_def: Gibberella zeae PH-1 chromosome 4 hypothetical protein (FG07257.1) partial mRNA hsp_num: 2 from: 407 to: 442 | |||
| gi-nr: gi|90954574 gi_def: Uncultured sulfate-reducing bacterium partial dsrAB gene for sulfite reductase, dissimilatory-type alpha subunit, clone 3c_20 hsp_num: 1 from: 626 to: 685 | |||
| gi-nr: gi|6460827 gi_def: Deinococcus radiodurans R1 plasmid MP1, complete sequence hsp_num: 1 from: 38520 to: 38570 | |||
Coding-DNA |
|||
| tacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaa | |||
| Protein-Sequence | |||
| *FRCHRRTSCCRSGKGRLYRPLHENSRVAVAPKIFFSTRC | |||
| Hit-Information Section | |||
| gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5745202 to: 5745270 | |||
| gi-nr: gi|66934576 gi_def: Pseudomonas viridiflava strain RMX23.1a pectate lyase gene, complete cds hsp_num: 1 from: 707 to: 742 | |||
| gi-nr: gi|46125758 gi_def: Gibberella zeae PH-1 chromosome 4 hypothetical protein (FG07257.1) partial mRNA hsp_num: 2 from: 407 to: 442 | |||
| gi-nr: gi|90954574 gi_def: Uncultured sulfate-reducing bacterium partial dsrAB gene for sulfite reductase, dissimilatory-type alpha subunit, clone 3c_20 hsp_num: 1 from: 626 to: 685 | |||
| gi-nr: gi|6460827 gi_def: Deinococcus radiodurans R1 plasmid MP1, complete sequence hsp_num: 1 from: 38520 to: 38570 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_064|beg|2186|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| cagaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggtaatgctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatcat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggta | |||
| Protein-Sequence | |||
| EYRYGYSWPVFGVWWR*C | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatc | |||
| Protein-Sequence | |||
| CCFTVLYYRKFGMIANIALMANLVLI | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438821 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755947 to: 756018 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058685 to: 1058756 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618345 to: 618416 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204269 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287953 to: 288024 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56350 to: 56421 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1399 to: 1470 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110787 to: 1110858 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1461 to: 1532 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511552 to: 3511623 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197625 to: 3197696 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550670 to: 3550741 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804784 to: 804855 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983060 to: 2983131 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052169 to: 1052240 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125029 to: 1125100 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124741 to: 1124812 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170830 to: 1170901 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846303 to: 2846374 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694767 to: 2694838 | |||
Coding-DNA |
|||
| agaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggta | |||
| Protein-Sequence | |||
| EYRYGYSWPVFGVWWR*C | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| ctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatc | |||
| Protein-Sequence | |||
| CCFTVLYYRKFGMIANIALMANLVLI | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438821 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755947 to: 756018 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058685 to: 1058756 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618345 to: 618416 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204269 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287953 to: 288024 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56350 to: 56421 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1399 to: 1470 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110787 to: 1110858 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1461 to: 1532 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511552 to: 3511623 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197625 to: 3197696 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550670 to: 3550741 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804784 to: 804855 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983060 to: 2983131 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052169 to: 1052240 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125029 to: 1125100 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124741 to: 1124812 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170830 to: 1170901 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846303 to: 2846374 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694767 to: 2694838 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_065|beg|2163|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| ccattggtccatcaatgggtcagTcaTgaatatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcacta | |||
| Protein-Sequence | |||
| ISIWVFRPVFGVLVAVMLFTVLYYRKFGMIANIAL | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755929 to: 755997 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438771 to: 438839 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058667 to: 1058735 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618327 to: 618395 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287935 to: 288003 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56371 to: 56439 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125472 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1482 to: 1559 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694788 to: 2694856 | |||
Coding-DNA |
|||
| tatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcacta | |||
| Protein-Sequence | |||
| ISIWVFRPVFGVLVAVMLFTVLYYRKFGMIANIAL | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755929 to: 755997 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438771 to: 438839 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058667 to: 1058735 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618327 to: 618395 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287935 to: 288003 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56371 to: 56439 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125472 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1482 to: 1559 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694788 to: 2694856 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_066|beg|2422|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| gcgtattcgtgaagagtacgTcgaaggaaaaaatccTgcTagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatcattttgt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatca | |||
| Protein-Sequence | |||
| QAIHQGYANAFSTIADANITTLNYGDH | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058969 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438602 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756231 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618629 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204050 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 367 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694631 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131121 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493739 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361929 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881350 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728568 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273933 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733108 to: 1733182 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667406 to: 1667480 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244424 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684062 to: 1684136 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612634 to: 1612708 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636914 to: 1636988 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649353 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284214 to: 2284294 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239732 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511339 to: 3511404 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197412 to: 3197477 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550457 to: 3550522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805068 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1683 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982847 to: 2982912 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052453 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125313 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125025 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436588 to: 3436653 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13387 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205218 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409034 to: 2409099 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524882 to: 2524947 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508505 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1683 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420949 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902711 to: 1902776 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694180 to: 2694242 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852510 to: 1852572 | |||
Coding-DNA |
|||
| aagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatca | |||
| Protein-Sequence | |||
| QAIHQGYANAFSTIADANITTLNYGDH | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058969 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438602 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756231 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618629 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204050 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 367 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694631 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131121 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493739 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361929 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881350 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728568 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273933 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733108 to: 1733182 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667406 to: 1667480 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244424 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684062 to: 1684136 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612634 to: 1612708 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636914 to: 1636988 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649353 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284214 to: 2284294 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239732 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511339 to: 3511404 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197412 to: 3197477 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550457 to: 3550522 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805068 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1683 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982847 to: 2982912 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052453 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125313 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125025 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436588 to: 3436653 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13387 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205218 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409034 to: 2409099 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524882 to: 2524947 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508505 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1683 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420949 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902711 to: 1902776 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694180 to: 2694242 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852510 to: 1852572 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_068|beg|1719|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| cTtgcggcTagcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaagcTgcgtgattctgggtggttcaacattaTccgatgcTaagctcaagcgccgacgaatatggt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaag | |||
| Protein-Sequence | |||
| *QDVRLLAAKSSSYRNGRPVVLKK | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204717 to: 2204746 | |||
Coding-DNA |
|||
| gcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaag | |||
| Protein-Sequence | |||
| *QDVRLLAAKSSSYRNGRPVVLKK | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204717 to: 2204746 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_070|beg|2756|length|114|forward|gi | ||
| Query_DNA-Sequence | |||
| cgaaaattcgccttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctcaactgggggctggatttcacgggcggtactttgattgaagtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gaaaattcgccttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctcaactgggggctggatttcacgggcggtactttgattgaagtg | |||
| Protein-Sequence | |||
| RKFAFALSLVMIAASIFTLSTKWLNWGLDFTGGTLIEV | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288468 to: 288578 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438196 to: 438306 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756462 to: 756572 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1059200 to: 1059310 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618860 to: 618970 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203646 to: 2203756 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131349 to: 131459 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_071|beg|1265|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| atggaaaaatttggtcagccaacaagaagaagctttccgcagtgatctgcTgtgacgagaaaattcgttaccgcgcgatccgtccatttatcggatgcggttgaagtgaccctgcgtgatgccgaTgcagc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_074|beg|245|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| taacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctTacgcgTcgtcgtaaccgcgaagtgccTaccactacaaaaagacaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttc | |||
| Protein-Sequence | |||
| TCVTYQRLMESIRKAIDEDRFDQFVAEF | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056630 to: 1056701 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616305 to: 616376 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440745 to: 440816 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753952 to: 754023 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393415 to: 2393486 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156590 to: 1156661 | |||
Coding-DNA |
|||
| aacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttc | |||
| Protein-Sequence | |||
| TCVTYQRLMESIRKAIDEDRFDQFVAEF | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056630 to: 1056701 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616305 to: 616376 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440745 to: 440816 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753952 to: 754023 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393415 to: 2393486 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156590 to: 1156661 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_075|beg|2172|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| catcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaTctaccgtaagtttggcatgattgc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaT | |||
| Protein-Sequence | |||
| HQWVSMNIDMGIQACIWGMVAVMLFTVLY | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287899 to: 287967 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 797189 to: 797257 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 1351 to: 1419 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058631 to: 1058699 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438807 to: 438875 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755893 to: 755961 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618291 to: 618359 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130783 to: 130851 | |||
Coding-DNA |
|||
| atcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaT | |||
| Protein-Sequence | |||
| HQWVSMNIDMGIQACIWGMVAVMLFTVLY | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287899 to: 287967 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 797189 to: 797257 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 1351 to: 1419 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058631 to: 1058699 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438807 to: 438875 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755893 to: 755961 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618291 to: 618359 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130783 to: 130851 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_077|beg|1719|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaagcattaccgatgcaagc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaa | |||
| Protein-Sequence | |||
| CLEPPRITRFFSTTGRPLRSNLISLPAGARPACR | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 796726 to: 796818 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 888 to: 980 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287436 to: 287528 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204694 to: 2204783 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058171 to: 1058254 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439246 to: 439335 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755433 to: 755522 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617831 to: 617920 | |||
Coding-DNA |
|||
| tgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaa | |||
| Protein-Sequence | |||
| CLEPPRITRFFSTTGRPLRSNLISLPAGARPACR | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 796726 to: 796818 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 888 to: 980 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287436 to: 287528 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204694 to: 2204783 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058171 to: 1058254 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439246 to: 439335 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755433 to: 755522 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617831 to: 617920 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_079|beg|78|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| tttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgactggttacacttTgcaaaaattattcgTaagtcatacc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgac | |||
| Protein-Sequence | |||
| FVTGGVIKIRNAAHKTDTTPLDPHCD | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440919 to: 440996 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753772 to: 753849 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056450 to: 1056527 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616125 to: 616202 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128751 to: 128828 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206379 to: 2206456 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478528 to: 1478605 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399703 to: 399780 | |||
Coding-DNA |
|||
| ttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgac | |||
| Protein-Sequence | |||
| FVTGGVIKIRNAAHKTDTTPLDPHCD | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440919 to: 440996 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753772 to: 753849 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056450 to: 1056527 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616125 to: 616202 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128751 to: 128828 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206379 to: 2206456 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478528 to: 1478605 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399703 to: 399780 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_083|beg|1468|length|109|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcaTctattttgcgtTaaccgggtgaacgaactgggtgtTg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcaT | |||
| Protein-Sequence | |||
| VLVAKFTEARLQEIRNYAVEQNII | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130063 to: 130131 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439527 to: 439592 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755176 to: 755241 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057914 to: 1057979 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617574 to: 617639 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204975 to: 2205040 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_086|beg|2367|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| ctggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaagTcgatttcatcaaggttacgctaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaa | |||
| Protein-Sequence | |||
| LVIVLTVGMAVDANVTDFRALFREELREGKNPQQ | |||
| Hit-Information Section | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 269 to: 304 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756133 to: 756168 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438600 to: 438635 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204048 to: 2204083 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480843 to: 1480878 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 131023 to: 131058 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176414 to: 176452 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63229 to: 63267 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45293 to: 45331 | |||
Coding-DNA |
|||
| tggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaa | |||
| Protein-Sequence | |||
| LVIVLTVGMAVDANVTDFRALFREELREGKNPQQ | |||
| Hit-Information Section | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 269 to: 304 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756133 to: 756168 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438600 to: 438635 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204048 to: 2204083 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480843 to: 1480878 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 131023 to: 131058 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176414 to: 176452 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63229 to: 63267 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45293 to: 45331 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_090|beg|2770|length|116|forward|gi | ||
| Query_DNA-Sequence | |||
| gccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTgggggctggatttcacgggcggtacTtttgattgaagtgggcttttgaacagc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTggggg | |||
| Protein-Sequence | |||
| LVAGDDCRIDFLLCLPSGSTWG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703867 gi_def: Synthetic construct Vibrio cholerae clone FLH175184.01F secF-1 gene, complete sequence hsp_num: 3 from: 95 to: 130 | |||
Coding-DNA |
|||
| ccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTggggg | |||
| Protein-Sequence | |||
| LVAGDDCRIDFLLCLPSGSTWG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703867 gi_def: Synthetic construct Vibrio cholerae clone FLH175184.01F secF-1 gene, complete sequence hsp_num: 3 from: 95 to: 130 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_094|beg|29|length|101|forward|gi | ||
| Query_DNA-Sequence | |||
| catgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgtTaatgcagcacataaaaccgata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgt | |||
| Protein-Sequence | |||
| HVDCVMPTRNARNGHLFVTGGVIKIR | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 285746 to: 285817 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056408 to: 1056479 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440967 to: 441038 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753730 to: 753801 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616083 to: 616154 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128709 to: 128780 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206427 to: 2206498 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168705 to: 1168776 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555529 to: 2555600 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459801 to: 459872 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490718 to: 490789 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513760 to: 3513831 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399661 to: 399732 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976333 to: 976404 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199833 to: 3199904 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439019 to: 3439090 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442898 to: 442969 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552878 to: 3552949 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802576 to: 802647 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390523 to: 390594 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494416 to: 494487 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 790 to: 861 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478486 to: 1478557 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985268 to: 2985339 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049961 to: 1050032 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122821 to: 1122892 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441309 to: 441380 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356424 to: 356495 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108669 to: 1108740 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426150 to: 426221 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426150 to: 426221 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10984 to: 11055 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501117 to: 501188 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355559 to: 355630 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122533 to: 1122604 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273709 to: 1273780 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58532 to: 58603 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202815 to: 202886 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490555 to: 490626 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411366 to: 2411437 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527214 to: 2527285 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506102 to: 506173 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490557 to: 490628 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6376 to: 6447 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316912 to: 316983 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315897 to: 315968 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412020 to: 412091 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1004 to: 1075 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1005 to: 1076 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334989 to: 335060 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848421 to: 2848492 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156812 to: 1156883 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728403 to: 728474 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352370 to: 352441 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554293 to: 1554364 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271876 to: 271947 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335505 to: 335576 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139943 to: 140014 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139453 to: 139524 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696990 to: 2697061 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627094 to: 627165 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496000 to: 3496071 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804873 to: 2804944 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831861 to: 831932 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900336 to: 1900407 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246768 to: 1246839 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505969 to: 1506040 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279653 to: 4279724 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117097 to: 1117168 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3838 to: 3909 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143626 to: 1143697 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307001 to: 1307072 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985599 to: 985670 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054196 to: 1054267 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970933 to: 971004 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879314 to: 3879385 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551080 to: 551151 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364178 to: 3364249 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883600 to: 2883671 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730840 to: 2730911 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276182 to: 3276253 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730787 to: 1730858 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651606 to: 2651677 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246672 to: 3246743 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681742 to: 1681813 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634592 to: 1634663 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2924 to: 2995 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3639 to: 3710 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3640 to: 3711 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9802 to: 9873 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3032 to: 3103 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822751 to: 1822822 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219795 to: 5219866 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696537 to: 2696608 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726365 to: 5726436 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 39 to: 110 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553841 to: 1553912 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280946 to: 3281017 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387216 to: 1387287 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827102 to: 827173 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091266 to: 1091337 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161629 to: 1161700 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829003 to: 829074 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130277 to: 1130348 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 793 to: 864 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 871 to: 942 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825347 to: 825418 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130326 to: 1130397 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267331 to: 267402 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481714 to: 481785 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864236 to: 1864295 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393723 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108364 to: 2108417 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 39143 to: 39214 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889562 to: 889633 | |||
Coding-DNA |
|||
| atgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgt | |||
| Protein-Sequence | |||
| HVDCVMPTRNARNGHLFVTGGVIKIR | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 285746 to: 285817 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056408 to: 1056479 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440967 to: 441038 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753730 to: 753801 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616083 to: 616154 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128709 to: 128780 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206427 to: 2206498 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168705 to: 1168776 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555529 to: 2555600 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459801 to: 459872 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490718 to: 490789 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513760 to: 3513831 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399661 to: 399732 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976333 to: 976404 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199833 to: 3199904 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439019 to: 3439090 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442898 to: 442969 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552878 to: 3552949 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802576 to: 802647 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390523 to: 390594 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494416 to: 494487 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 790 to: 861 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478486 to: 1478557 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985268 to: 2985339 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049961 to: 1050032 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122821 to: 1122892 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441309 to: 441380 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356424 to: 356495 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108669 to: 1108740 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426150 to: 426221 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426150 to: 426221 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10984 to: 11055 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501117 to: 501188 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355559 to: 355630 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122533 to: 1122604 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273709 to: 1273780 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58532 to: 58603 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202815 to: 202886 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490555 to: 490626 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411366 to: 2411437 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527214 to: 2527285 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506102 to: 506173 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490557 to: 490628 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6376 to: 6447 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316912 to: 316983 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315897 to: 315968 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412020 to: 412091 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1004 to: 1075 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1005 to: 1076 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334989 to: 335060 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848421 to: 2848492 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156812 to: 1156883 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728403 to: 728474 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352370 to: 352441 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554293 to: 1554364 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271876 to: 271947 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335505 to: 335576 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139943 to: 140014 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139453 to: 139524 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696990 to: 2697061 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627094 to: 627165 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496000 to: 3496071 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804873 to: 2804944 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831861 to: 831932 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900336 to: 1900407 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246768 to: 1246839 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505969 to: 1506040 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279653 to: 4279724 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117097 to: 1117168 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3838 to: 3909 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143626 to: 1143697 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307001 to: 1307072 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985599 to: 985670 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054196 to: 1054267 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970933 to: 971004 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879314 to: 3879385 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551080 to: 551151 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364178 to: 3364249 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883600 to: 2883671 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730840 to: 2730911 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276182 to: 3276253 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730787 to: 1730858 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651606 to: 2651677 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246672 to: 3246743 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681742 to: 1681813 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634592 to: 1634663 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2924 to: 2995 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3639 to: 3710 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3640 to: 3711 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9802 to: 9873 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3032 to: 3103 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822751 to: 1822822 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219795 to: 5219866 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696537 to: 2696608 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726365 to: 5726436 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 39 to: 110 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553841 to: 1553912 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280946 to: 3281017 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387216 to: 1387287 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827102 to: 827173 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091266 to: 1091337 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161629 to: 1161700 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829003 to: 829074 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130277 to: 1130348 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 793 to: 864 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 871 to: 942 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825347 to: 825418 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130326 to: 1130397 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267331 to: 267402 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481714 to: 481785 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864236 to: 1864295 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393723 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108364 to: 2108417 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 39143 to: 39214 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889562 to: 889633 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_100|beg|2179|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| gggtcagcagaatatcgatatgggtattcaggcctTgtatttggggtatggtggcggtaatgctgtttacggtttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggtcagcagaatatcgatatgggtattcaggcctTgtatttggggtatggtggcggta | |||
| Protein-Sequence | |||
| GSAEYRYGYSGLVFGVWWR*C | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1376 to: 1414 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797214 to: 797252 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287924 to: 287962 | |||
| gi-nr: gi|71993102 gi_def: Caenorhabditis elegans K04C1.3 (K04C1.3) mRNA, complete cds hsp_num: 1 from: 485 to: 511 | |||
Coding-DNA |
|||
| ctgtttacggtttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcg | |||
| Protein-Sequence | |||
| CCLRFLYYRKFGMIANIALMA | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1376 to: 1414 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755956 to: 756003 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438765 to: 438812 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797214 to: 797252 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058694 to: 1058741 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618354 to: 618401 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287924 to: 287962 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287962 to: 288009 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694832 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1476 to: 1523 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_101|beg|1165|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| ccatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaattggtcagccaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| catattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaat | |||
| Protein-Sequence | |||
| PYWLESIGAAPMKLGLDLRGGVHFLMEVDMDAAMEN | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439797 to: 439901 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754867 to: 754971 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129760 to: 129864 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057605 to: 1057709 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617265 to: 617369 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205248 to: 2205349 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479589 to: 1479690 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109716 to: 1109817 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285465 to: 2285566 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803763 to: 2803864 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512593 to: 3512694 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198666 to: 3198767 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376678 to: 3376779 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551711 to: 3551812 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803713 to: 803814 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 328 to: 429 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984101 to: 2984202 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051098 to: 1051199 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123958 to: 1124059 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123670 to: 1123771 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882530 to: 2882631 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666125 to: 1666226 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1682781 to: 1682882 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3363109 to: 3363210 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3275113 to: 3275214 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267391 to: 1267492 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245604 to: 3245705 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901415 to: 1901516 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695443 to: 2695547 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40112 to: 40219 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 328 to: 429 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766264 to: 2766365 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46397 to: 46468 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888297 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64333 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177518 to: 177589 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12622 | |||
Coding-DNA |
|||
| catattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaat | |||
| Protein-Sequence | |||
| PYWLESIGAAPMKLGLDLRGGVHFLMEVDMDAAMEN | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439797 to: 439901 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754867 to: 754971 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129760 to: 129864 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057605 to: 1057709 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617265 to: 617369 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205248 to: 2205349 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479589 to: 1479690 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109716 to: 1109817 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285465 to: 2285566 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803763 to: 2803864 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512593 to: 3512694 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198666 to: 3198767 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376678 to: 3376779 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551711 to: 3551812 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803713 to: 803814 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 328 to: 429 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984101 to: 2984202 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051098 to: 1051199 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123958 to: 1124059 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123670 to: 1123771 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882530 to: 2882631 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666125 to: 1666226 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1682781 to: 1682882 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3363109 to: 3363210 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3275113 to: 3275214 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267391 to: 1267492 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245604 to: 3245705 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901415 to: 1901516 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695443 to: 2695547 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40112 to: 40219 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 328 to: 429 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766264 to: 2766365 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46397 to: 46468 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888297 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64333 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177518 to: 177589 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12622 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_102|beg|3|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccgtaatgcagcactaaaaccgatacaacaccact | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccg | |||
| Protein-Sequence | |||
| VEGVRRGIDMFDCVMPTRNARNGHLFVDGWCDQDP | |||
| Hit-Information Section | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 4 from: 843 to: 878 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206531 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056375 to: 1056461 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616050 to: 616136 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128676 to: 128762 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58556 to: 58636 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 971 to: 1051 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 972 to: 1052 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 757 to: 837 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6343 to: 6423 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202782 to: 202862 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10951 to: 11031 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1306968 to: 1307051 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985566 to: 985649 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879335 to: 3879418 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246735 to: 1246818 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279674 to: 4279757 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054163 to: 1054246 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970900 to: 970983 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2945 to: 3028 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3660 to: 3743 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3661 to: 3744 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9823 to: 9906 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3053 to: 3136 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219816 to: 5219899 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726386 to: 5726469 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 60 to: 143 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553808 to: 1553891 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139420 to: 139500 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280967 to: 3281050 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108331 to: 2108426 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512598 to: 1512681 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143593 to: 1143676 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387183 to: 1387266 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168672 to: 1168752 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555553 to: 2555633 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459768 to: 459848 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490685 to: 490765 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335013 to: 335093 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848445 to: 2848525 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513784 to: 3513864 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399628 to: 399708 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156836 to: 1156916 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728427 to: 728507 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352337 to: 352417 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976300 to: 976380 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199857 to: 3199937 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831885 to: 831965 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439043 to: 3439123 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442865 to: 442945 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552902 to: 3552982 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505993 to: 1506073 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802543 to: 802623 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390490 to: 390570 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494383 to: 494463 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985292 to: 2985372 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049928 to: 1050008 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122788 to: 1122868 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441276 to: 441356 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356391 to: 356471 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554260 to: 1554340 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864203 to: 1864298 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3862 to: 3942 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108636 to: 1108716 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426117 to: 426197 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426117 to: 426197 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501084 to: 501164 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355526 to: 355606 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122500 to: 1122580 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490522 to: 490602 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411390 to: 2411470 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527238 to: 2527318 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506069 to: 506149 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117064 to: 1117144 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271900 to: 271980 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490524 to: 490604 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316936 to: 317016 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315864 to: 315944 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 411987 to: 412067 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627061 to: 627141 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478453 to: 1478533 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273676 to: 1273756 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697017 to: 2697094 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665053 to: 1665130 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900303 to: 1900380 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681709 to: 1681786 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610281 to: 1610358 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3242008 to: 3242085 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496027 to: 3496104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364205 to: 3364282 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2991998 to: 2992075 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883627 to: 2883704 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804900 to: 2804977 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730867 to: 2730944 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276209 to: 3276286 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730754 to: 1730831 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651633 to: 2651710 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246699 to: 3246776 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634559 to: 1634636 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139910 to: 139990 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335472 to: 335552 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2356524 to: 2356604 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551047 to: 551127 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696641 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393756 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163028 to: 3163105 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375500 to: 3375580 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822718 to: 1822795 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579577 to: 579657 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2613944 to: 2614021 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3051957 to: 3052034 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4175 to: 4252 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 4156 to: 4233 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2099877 to: 2099954 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2634171 to: 2634248 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481818 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949374 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322204 to: 322281 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339928 to: 340005 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760965 to: 761042 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889589 to: 889666 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65713 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178900 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48822 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712874 to: 712951 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688220 to: 688297 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448268 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2209282 to: 2209359 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827069 to: 827146 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091293 to: 1091370 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161656 to: 1161733 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 828970 to: 829047 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130304 to: 1130381 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 760 to: 837 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 838 to: 915 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825314 to: 825391 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130353 to: 1130430 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4599122 to: 4599199 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 954141 to: 954218 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 664236 to: 664313 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4111855 to: 4111932 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803368 to: 803445 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684696 to: 684773 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254192 to: 254269 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 886453 to: 886530 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 1107980 to: 1108057 | |||
| gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906013 to: 906090 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706145 to: 706222 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267298 to: 267378 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 1033517 to: 1033594 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939501 to: 939578 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 200 | |||
| gi-nr: gi|149931032 gi_def: Bacteroides vulgatus ATCC 8482, complete genome hsp_num: 1 from: 3980335 to: 3980412 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750358 to: 750435 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299992 to: 300069 | |||
| gi-nr: gi|29342101 gi_def: Bacteroides thetaiotaomicron VPI-5482, complete genome hsp_num: 1 from: 1030592 to: 1030669 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 983079 to: 983156 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529878 to: 3529955 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 956573 to: 956650 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 703555 to: 703632 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1855301 to: 1855378 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 949034 to: 949111 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 942366 to: 942443 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1019853 to: 1019930 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59585 to: 59662 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393616 to: 393693 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693193 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919679 to: 2919756 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200944 to: 3201021 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2889377 to: 2889454 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830744 to: 830821 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749976 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295883 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542927 to: 2543004 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283000 to: 3283077 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267130 to: 3267207 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191233 to: 1191310 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302223 to: 302300 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899142 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417782 to: 1417859 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369758 to: 3369835 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527889 to: 527966 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491540 to: 2491617 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693060 to: 3693137 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079053 to: 3079130 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434258 to: 3434335 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427533 to: 1427610 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992232 to: 1992309 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867742 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244878 to: 244961 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1926406 to: 1926483 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535394 to: 535471 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 939542 to: 939619 | |||
| gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354214 to: 1354291 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1822939 to: 1823016 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733330 to: 733404 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 1298389 to: 1298469 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1731798 to: 1731866 | |||
| gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 2 to: 70 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1512852 to: 1512929 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1063688 to: 1063756 | |||
| gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2817948 to: 2818016 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575206 to: 1575280 | |||
| gi-nr: gi|115249003 gi_def: Clostridium difficile 630 complete genome hsp_num: 1 from: 3272861 to: 3272929 | |||
| gi-nr: gi|116101968 gi_def: Pediococcus pentosaceus ATCC 25745, complete genome hsp_num: 1 from: 1256440 to: 1256508 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2410558 to: 2410626 | |||
| gi-nr: gi|125496804 gi_def: Streptococcus sanguinis SK36, complete genome hsp_num: 1 from: 106507 to: 106575 | |||
| gi-nr: gi|24378526 gi_def: Streptococcus mutans UA159, complete genome hsp_num: 1 from: 288856 to: 288924 | |||
| gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8478 to: 8555 | |||
| gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1833 to: 1910 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1146464 to: 1146532 | |||
| gi-nr: gi|116100249 gi_def: Streptococcus thermophilus LMD-9, complete genome hsp_num: 1 from: 1668310 to: 1668378 | |||
| gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638383 to: 1638451 | |||
| gi-nr: gi|55737978 gi_def: Streptococcus thermophilus CNRZ1066, complete genome hsp_num: 1 from: 1617034 to: 1617102 | |||
| gi-nr: gi|56908016 gi_def: Bacillus clausii KSM-K16 DNA, complete genome hsp_num: 1 from: 1681227 to: 1681295 | |||
| gi-nr: gi|47118318 gi_def: Bacillus halodurans C-125 DNA, complete genome hsp_num: 1 from: 1321005 to: 1321073 | |||
| gi-nr: gi|55736088 gi_def: Streptococcus thermophilus LMG 18311, complete genome hsp_num: 1 from: 1614722 to: 1614790 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5881327 to: 5881395 | |||
| gi-nr: gi|156095826 gi_def: Plasmodium vivax queuine tRNA ribosyltransferase, putative (PVX_101010) mRNA, complete cds hsp_num: 1 from: 1246 to: 1311 | |||
| gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199453 to: 1199524 | |||
| gi-nr: gi|156720466 gi_def: Staphylococcus aureus subsp. aureus Mu3 DNA, complete genome hsp_num: 1 from: 1752219 to: 1752272 | |||
| gi-nr: gi|150373012 gi_def: Staphylococcus aureus subsp. aureus str. Newman genomic DNA, complete genome hsp_num: 1 from: 1709717 to: 1709770 | |||
| gi-nr: gi|149944932 gi_def: Staphylococcus aureus subsp. aureus JH1, complete genome hsp_num: 1 from: 1799061 to: 1799114 | |||
| gi-nr: gi|147739516 gi_def: Staphylococcus aureus subsp. aureus JH9, complete genome hsp_num: 1 from: 1799187 to: 1799240 | |||
| gi-nr: gi|47208328 gi_def: Staphylococcus aureus subsp. aureus Mu50 DNA, complete genome hsp_num: 1 from: 1750819 to: 1750872 | |||
| gi-nr: gi|68445725 gi_def: Staphylococcus haemolyticus JCSC1435 DNA, complete genome hsp_num: 1 from: 1313764 to: 1313817 | |||
| gi-nr: gi|57284222 gi_def: Staphylococcus aureus subsp. aureus COL, complete genome hsp_num: 1 from: 1726878 to: 1726931 | |||
| gi-nr: gi|87201381 gi_def: Staphylococcus aureus subsp. aureus NCTC 8325, complete genome hsp_num: 1 from: 1652918 to: 1652971 | |||
| gi-nr: gi|87125858 gi_def: Staphylococcus aureus subsp. aureus USA300_FPR3757, complete genome hsp_num: 1 from: 1749715 to: 1749768 | |||
| gi-nr: gi|72493824 gi_def: Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 DNA, complete genome hsp_num: 1 from: 1165599 to: 1165652 | |||
| gi-nr: gi|49243355 gi_def: Staphylococcus aureus strain MSSA476, complete genome hsp_num: 1 from: 1699534 to: 1699587 | |||
| gi-nr: gi|47118312 gi_def: Staphylococcus aureus subsp. aureus MW2 DNA, complete genome, strain:MW2 hsp_num: 1 from: 1719882 to: 1719935 | |||
| gi-nr: gi|47118324 gi_def: Staphylococcus aureus subsp. aureus N315 genomic DNA, complete genome hsp_num: 1 from: 1674406 to: 1674459 | |||
| gi-nr: gi|57636010 gi_def: Staphylococcus epidermidis RP62A, complete genome hsp_num: 1 from: 1242323 to: 1242376 | |||
| gi-nr: gi|27316888 gi_def: Staphylococcus epidermidis ATCC 12228, complete genome hsp_num: 1 from: 1354398 to: 1354451 | |||
| gi-nr: gi|49240382 gi_def: Staphylococcus aureus subsp. aureus strain MRSA252, complete genome hsp_num: 1 from: 1784865 to: 1784918 | |||
| gi-nr: gi|82655308 gi_def: Staphylococcus aureus RF122 complete genome hsp_num: 1 from: 1628943 to: 1628996 | |||
| gi-nr: gi|33632062 gi_def: Synechococcus sp. WH8102 complete genome; segment 1/7 hsp_num: 2 from: 107654 to: 107683 | |||
| gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1296 | |||
Coding-DNA |
|||
| gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccg | |||
| Protein-Sequence | |||
| VEGVRRGIDMFDCVMPTRNARNGHLFVDGWCDQDP | |||
| Hit-Information Section | |||
| gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 4 from: 843 to: 878 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206531 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056375 to: 1056461 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616050 to: 616136 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128676 to: 128762 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58556 to: 58636 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 971 to: 1051 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 972 to: 1052 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 757 to: 837 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6343 to: 6423 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202782 to: 202862 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10951 to: 11031 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1306968 to: 1307051 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985566 to: 985649 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879335 to: 3879418 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246735 to: 1246818 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279674 to: 4279757 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054163 to: 1054246 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970900 to: 970983 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2945 to: 3028 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3660 to: 3743 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3661 to: 3744 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9823 to: 9906 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3053 to: 3136 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219816 to: 5219899 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726386 to: 5726469 | |||
| gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 60 to: 143 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553808 to: 1553891 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139420 to: 139500 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280967 to: 3281050 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108331 to: 2108426 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512598 to: 1512681 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143593 to: 1143676 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387183 to: 1387266 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168672 to: 1168752 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555553 to: 2555633 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459768 to: 459848 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490685 to: 490765 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335013 to: 335093 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848445 to: 2848525 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513784 to: 3513864 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399628 to: 399708 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156836 to: 1156916 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728427 to: 728507 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352337 to: 352417 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976300 to: 976380 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199857 to: 3199937 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831885 to: 831965 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439043 to: 3439123 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442865 to: 442945 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552902 to: 3552982 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505993 to: 1506073 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802543 to: 802623 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390490 to: 390570 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494383 to: 494463 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985292 to: 2985372 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049928 to: 1050008 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122788 to: 1122868 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441276 to: 441356 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356391 to: 356471 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554260 to: 1554340 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864203 to: 1864298 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3862 to: 3942 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108636 to: 1108716 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426117 to: 426197 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426117 to: 426197 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501084 to: 501164 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355526 to: 355606 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122500 to: 1122580 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490522 to: 490602 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411390 to: 2411470 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527238 to: 2527318 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506069 to: 506149 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117064 to: 1117144 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271900 to: 271980 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490524 to: 490604 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316936 to: 317016 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315864 to: 315944 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 411987 to: 412067 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627061 to: 627141 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478453 to: 1478533 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273676 to: 1273756 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697017 to: 2697094 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665053 to: 1665130 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900303 to: 1900380 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681709 to: 1681786 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610281 to: 1610358 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3242008 to: 3242085 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496027 to: 3496104 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364205 to: 3364282 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2991998 to: 2992075 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883627 to: 2883704 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804900 to: 2804977 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730867 to: 2730944 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276209 to: 3276286 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730754 to: 1730831 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651633 to: 2651710 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246699 to: 3246776 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634559 to: 1634636 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139910 to: 139990 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335472 to: 335552 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2356524 to: 2356604 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551047 to: 551127 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696641 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393756 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163028 to: 3163105 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375500 to: 3375580 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822718 to: 1822795 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579577 to: 579657 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2613944 to: 2614021 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3051957 to: 3052034 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4175 to: 4252 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 4156 to: 4233 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2099877 to: 2099954 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2634171 to: 2634248 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481818 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949374 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322204 to: 322281 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339928 to: 340005 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760965 to: 761042 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889589 to: 889666 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65713 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178900 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48822 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712874 to: 712951 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688220 to: 688297 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448268 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2209282 to: 2209359 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827069 to: 827146 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091293 to: 1091370 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161656 to: 1161733 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 828970 to: 829047 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130304 to: 1130381 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 760 to: 837 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 838 to: 915 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825314 to: 825391 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130353 to: 1130430 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4599122 to: 4599199 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 954141 to: 954218 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 664236 to: 664313 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4111855 to: 4111932 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803368 to: 803445 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684696 to: 684773 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254192 to: 254269 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 886453 to: 886530 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 1107980 to: 1108057 | |||
| gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906013 to: 906090 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706145 to: 706222 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267298 to: 267378 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 1033517 to: 1033594 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939501 to: 939578 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 200 | |||
| gi-nr: gi|149931032 gi_def: Bacteroides vulgatus ATCC 8482, complete genome hsp_num: 1 from: 3980335 to: 3980412 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750358 to: 750435 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299992 to: 300069 | |||
| gi-nr: gi|29342101 gi_def: Bacteroides thetaiotaomicron VPI-5482, complete genome hsp_num: 1 from: 1030592 to: 1030669 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 983079 to: 983156 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529878 to: 3529955 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 956573 to: 956650 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 703555 to: 703632 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1855301 to: 1855378 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 949034 to: 949111 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 942366 to: 942443 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1019853 to: 1019930 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59585 to: 59662 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393616 to: 393693 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693193 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919679 to: 2919756 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200944 to: 3201021 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2889377 to: 2889454 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830744 to: 830821 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749976 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295883 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542927 to: 2543004 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283000 to: 3283077 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267130 to: 3267207 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191233 to: 1191310 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302223 to: 302300 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899142 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417782 to: 1417859 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369758 to: 3369835 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527889 to: 527966 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491540 to: 2491617 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693060 to: 3693137 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079053 to: 3079130 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434258 to: 3434335 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427533 to: 1427610 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992232 to: 1992309 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867742 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244878 to: 244961 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1926406 to: 1926483 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535394 to: 535471 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 939542 to: 939619 | |||
| gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354214 to: 1354291 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1822939 to: 1823016 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733330 to: 733404 | |||
| gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 1298389 to: 1298469 | |||
| gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1731798 to: 1731866 | |||
| gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 2 to: 70 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1512852 to: 1512929 | |||
| gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1063688 to: 1063756 | |||
| gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2817948 to: 2818016 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575206 to: 1575280 | |||
| gi-nr: gi|115249003 gi_def: Clostridium difficile 630 complete genome hsp_num: 1 from: 3272861 to: 3272929 | |||
| gi-nr: gi|116101968 gi_def: Pediococcus pentosaceus ATCC 25745, complete genome hsp_num: 1 from: 1256440 to: 1256508 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2410558 to: 2410626 | |||
| gi-nr: gi|125496804 gi_def: Streptococcus sanguinis SK36, complete genome hsp_num: 1 from: 106507 to: 106575 | |||
| gi-nr: gi|24378526 gi_def: Streptococcus mutans UA159, complete genome hsp_num: 1 from: 288856 to: 288924 | |||
| gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8478 to: 8555 | |||
| gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1833 to: 1910 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1146464 to: 1146532 | |||
| gi-nr: gi|116100249 gi_def: Streptococcus thermophilus LMD-9, complete genome hsp_num: 1 from: 1668310 to: 1668378 | |||
| gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638383 to: 1638451 | |||
| gi-nr: gi|55737978 gi_def: Streptococcus thermophilus CNRZ1066, complete genome hsp_num: 1 from: 1617034 to: 1617102 | |||
| gi-nr: gi|56908016 gi_def: Bacillus clausii KSM-K16 DNA, complete genome hsp_num: 1 from: 1681227 to: 1681295 | |||
| gi-nr: gi|47118318 gi_def: Bacillus halodurans C-125 DNA, complete genome hsp_num: 1 from: 1321005 to: 1321073 | |||
| gi-nr: gi|55736088 gi_def: Streptococcus thermophilus LMG 18311, complete genome hsp_num: 1 from: 1614722 to: 1614790 | |||
| gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5881327 to: 5881395 | |||
| gi-nr: gi|156095826 gi_def: Plasmodium vivax queuine tRNA ribosyltransferase, putative (PVX_101010) mRNA, complete cds hsp_num: 1 from: 1246 to: 1311 | |||
| gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199453 to: 1199524 | |||
| gi-nr: gi|156720466 gi_def: Staphylococcus aureus subsp. aureus Mu3 DNA, complete genome hsp_num: 1 from: 1752219 to: 1752272 | |||
| gi-nr: gi|150373012 gi_def: Staphylococcus aureus subsp. aureus str. Newman genomic DNA, complete genome hsp_num: 1 from: 1709717 to: 1709770 | |||
| gi-nr: gi|149944932 gi_def: Staphylococcus aureus subsp. aureus JH1, complete genome hsp_num: 1 from: 1799061 to: 1799114 | |||
| gi-nr: gi|147739516 gi_def: Staphylococcus aureus subsp. aureus JH9, complete genome hsp_num: 1 from: 1799187 to: 1799240 | |||
| gi-nr: gi|47208328 gi_def: Staphylococcus aureus subsp. aureus Mu50 DNA, complete genome hsp_num: 1 from: 1750819 to: 1750872 | |||
| gi-nr: gi|68445725 gi_def: Staphylococcus haemolyticus JCSC1435 DNA, complete genome hsp_num: 1 from: 1313764 to: 1313817 | |||
| gi-nr: gi|57284222 gi_def: Staphylococcus aureus subsp. aureus COL, complete genome hsp_num: 1 from: 1726878 to: 1726931 | |||
| gi-nr: gi|87201381 gi_def: Staphylococcus aureus subsp. aureus NCTC 8325, complete genome hsp_num: 1 from: 1652918 to: 1652971 | |||
| gi-nr: gi|87125858 gi_def: Staphylococcus aureus subsp. aureus USA300_FPR3757, complete genome hsp_num: 1 from: 1749715 to: 1749768 | |||
| gi-nr: gi|72493824 gi_def: Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 DNA, complete genome hsp_num: 1 from: 1165599 to: 1165652 | |||
| gi-nr: gi|49243355 gi_def: Staphylococcus aureus strain MSSA476, complete genome hsp_num: 1 from: 1699534 to: 1699587 | |||
| gi-nr: gi|47118312 gi_def: Staphylococcus aureus subsp. aureus MW2 DNA, complete genome, strain:MW2 hsp_num: 1 from: 1719882 to: 1719935 | |||
| gi-nr: gi|47118324 gi_def: Staphylococcus aureus subsp. aureus N315 genomic DNA, complete genome hsp_num: 1 from: 1674406 to: 1674459 | |||
| gi-nr: gi|57636010 gi_def: Staphylococcus epidermidis RP62A, complete genome hsp_num: 1 from: 1242323 to: 1242376 | |||
| gi-nr: gi|27316888 gi_def: Staphylococcus epidermidis ATCC 12228, complete genome hsp_num: 1 from: 1354398 to: 1354451 | |||
| gi-nr: gi|49240382 gi_def: Staphylococcus aureus subsp. aureus strain MRSA252, complete genome hsp_num: 1 from: 1784865 to: 1784918 | |||
| gi-nr: gi|82655308 gi_def: Staphylococcus aureus RF122 complete genome hsp_num: 1 from: 1628943 to: 1628996 | |||
| gi-nr: gi|33632062 gi_def: Synechococcus sp. WH8102 complete genome; segment 1/7 hsp_num: 2 from: 107654 to: 107683 | |||
| gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1296 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_103|beg|240|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| atccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgta | |||
| Protein-Sequence | |||
| IHNPALLPTLDWKCIRKAIDEDRFDQFCSRVLRAS*P | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616326 to: 616364 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 616364 to: 616402 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393427 to: 2393465 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156602 to: 1156640 | |||
Coding-DNA |
|||
| tccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgta | |||
| Protein-Sequence | |||
| IHNPALLPTLDWKCIRKAIDEDRFDQFCSRVLRAS*P | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616326 to: 616364 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 616364 to: 616402 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393427 to: 2393465 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156602 to: 1156640 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_104|beg|1257|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| atgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccattatcggatgcggTt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccatta | |||
| Protein-Sequence | |||
| MPRWKNWSANNEEAFRSDLRDEKIRYRAIRPL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617388 to: 617447 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057728 to: 1057787 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439716 to: 439778 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754990 to: 755052 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205170 to: 2205226 | |||
Coding-DNA |
|||
| tgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccatta | |||
| Protein-Sequence | |||
| MPRWKNWSANNEEAFRSDLRDEKIRYRAIRPL | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617388 to: 617447 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057728 to: 1057787 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439716 to: 439778 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754990 to: 755052 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205170 to: 2205226 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_106|beg|2123|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| ggtgctttgattgcTgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatTggtggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatT | |||
| Protein-Sequence | |||
| MLPISIVEERTIGPSMGQQNIDMGIQACIWGI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058574 to: 1058669 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438837 to: 438932 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755836 to: 755931 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204285 to: 2204380 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618234 to: 618329 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130726 to: 130821 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 3 from: 44 to: 67 | |||
Coding-DNA |
|||
| aatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatT | |||
| Protein-Sequence | |||
| MLPISIVEERTIGPSMGQQNIDMGIQACIWGI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058574 to: 1058669 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438837 to: 438932 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755836 to: 755931 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204285 to: 2204380 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618234 to: 618329 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130726 to: 130821 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 3 from: 44 to: 67 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_108|beg|1406|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgcttctggagtcgaaacaccgtgatatgacctttacgTacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTggaaattcgca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| TacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTgg | |||
| Protein-Sequence | |||
| RTSESDGRFVLVAKFTEARLHG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 569 to: 607 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130042 to: 130095 | |||
Coding-DNA |
|||
| TacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTgg | |||
| Protein-Sequence | |||
| RTSESDGRFVLVAKFTEARLHG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 569 to: 607 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130042 to: 130095 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_109|beg|683|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| ctagtgggtgtatcactaaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctacc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_110|beg|1492|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| agctcgcttacaggaaattcgcaactTacgccgttgagcTagaaatcactattttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacaacgtatcgtgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgaca | |||
| Protein-Sequence | |||
| FCRNRVNELGVAEPLVQRQGAT | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057989 to: 1058048 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439458 to: 439517 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755251 to: 755310 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617649 to: 617708 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204906 to: 2204965 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987087 to: 987143 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877838 to: 3877894 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279475 to: 3279531 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267775 to: 1267831 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055684 to: 1055740 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1436 to: 1492 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8314 to: 8370 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1544 to: 1600 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514133 to: 1514189 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724882 to: 5724938 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130141 to: 130197 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972421 to: 972477 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388718 to: 1388774 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555342 to: 1555398 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218317 to: 5218373 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494583 to: 3494639 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847014 to: 2847070 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362773 to: 3362829 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308489 to: 1308545 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401083 to: 401139 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990462 to: 2990518 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882194 to: 2882250 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729412 to: 2729468 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274777 to: 3274833 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732208 to: 1732264 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650197 to: 2650253 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666506 to: 1666562 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248256 to: 1248312 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245268 to: 3245324 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683162 to: 1683218 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611734 to: 1611790 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278180 to: 4278236 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636014 to: 1636070 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110091 to: 1110147 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275237 to: 1275293 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57061 to: 57117 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803427 to: 2803483 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695481 to: 2695534 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901796 to: 1901852 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145409 to: 1145462 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597557 to: 4597610 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170134 to: 1170190 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554121 to: 2554177 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461224 to: 461280 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492141 to: 492197 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512263 to: 3512319 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977755 to: 977811 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198336 to: 3198392 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437512 to: 3437568 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444321 to: 444377 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551381 to: 3551437 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804088 to: 804144 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391946 to: 392002 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495839 to: 495895 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983771 to: 2983827 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051473 to: 1051529 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124333 to: 1124389 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164601 to: 3164654 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442732 to: 442788 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357847 to: 357903 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427573 to: 427629 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427573 to: 427629 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12407 to: 12463 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502540 to: 502596 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1792 to: 1848 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356982 to: 357038 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124045 to: 1124101 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204238 to: 204294 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491978 to: 492034 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409958 to: 2410014 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240576 to: 3240632 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525806 to: 2525862 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507525 to: 507581 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491980 to: 492036 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7799 to: 7855 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315504 to: 315560 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317320 to: 317376 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413443 to: 413499 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285135 to: 2285191 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233732 to: 233785 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172594 to: 2172650 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232457 to: 232510 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40490 to: 40543 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853437 to: 1853493 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419960 to: 1420016 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44986 to: 45042 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940387 to: 940440 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59265 to: 59318 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217944 to: 1217997 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301584 to: 301634 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085152 to: 1085205 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714398 to: 714451 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240623 to: 1240679 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12250 to: 12303 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6718 to: 6771 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514511 to: 1514567 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371597 to: 3371650 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446560 to: 1446613 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080843 to: 3080896 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765928 to: 2765984 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621798 to: 1621857 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301214 to: 301267 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968965 to: 969018 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887961 to: 888014 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241275 to: 2241334 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531376 to: 3531429 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218734 to: 2218793 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245241 to: 2245300 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832334 to: 832387 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63997 to: 64050 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177182 to: 177235 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46061 to: 46114 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695110 to: 2695163 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395217 to: 395267 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504466 to: 1504522 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202777 to: 3202830 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526149 to: 526202 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377059 to: 3377115 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482593 to: 4482643 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793822 to: 793875 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 580052 to: 580105 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261638 to: 4261688 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140982 to: 4141032 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169720 to: 5169770 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928879 to: 4928929 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578038 to: 578094 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612210 to: 2612263 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050228 to: 3050281 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2447 to: 2500 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2286 to: 2339 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101771 to: 2101824 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632437 to: 2632490 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921336 to: 2921386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3095292 to: 3095342 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1940250 to: 1940300 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3116613 to: 3116663 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65813 to: 65863 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2541041 to: 2541091 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3284953 to: 3285003 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3268964 to: 3269014 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1189347 to: 1189397 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 300337 to: 300387 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2489654 to: 2489704 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3695018 to: 3695068 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3436216 to: 3436266 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1425818 to: 1425868 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463654 to: 1463710 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552688 to: 552738 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257754 to: 3257801 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2000685 to: 2000732 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3014553 to: 3014600 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 897289 to: 897336 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332683 to: 332739 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354691 to: 354747 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073458 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1923435 to: 1923482 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5244189 to: 5244236 | |||
Coding-DNA |
|||
| ttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgaca | |||
| Protein-Sequence | |||
| FCRNRVNELGVAEPLVQRQGAT | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057989 to: 1058048 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439458 to: 439517 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755251 to: 755310 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617649 to: 617708 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204906 to: 2204965 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987087 to: 987143 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877838 to: 3877894 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279475 to: 3279531 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267775 to: 1267831 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055684 to: 1055740 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1436 to: 1492 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8314 to: 8370 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1544 to: 1600 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514133 to: 1514189 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724882 to: 5724938 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130141 to: 130197 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972421 to: 972477 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388718 to: 1388774 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555342 to: 1555398 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218317 to: 5218373 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494583 to: 3494639 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847014 to: 2847070 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362773 to: 3362829 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308489 to: 1308545 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401083 to: 401139 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990462 to: 2990518 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882194 to: 2882250 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729412 to: 2729468 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274777 to: 3274833 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732208 to: 1732264 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650197 to: 2650253 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666506 to: 1666562 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248256 to: 1248312 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245268 to: 3245324 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683162 to: 1683218 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611734 to: 1611790 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278180 to: 4278236 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636014 to: 1636070 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110091 to: 1110147 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275237 to: 1275293 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57061 to: 57117 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803427 to: 2803483 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695481 to: 2695534 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901796 to: 1901852 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145409 to: 1145462 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597557 to: 4597610 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170134 to: 1170190 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554121 to: 2554177 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461224 to: 461280 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492141 to: 492197 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512263 to: 3512319 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977755 to: 977811 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198336 to: 3198392 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437512 to: 3437568 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444321 to: 444377 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551381 to: 3551437 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804088 to: 804144 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391946 to: 392002 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495839 to: 495895 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983771 to: 2983827 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051473 to: 1051529 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124333 to: 1124389 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164601 to: 3164654 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442732 to: 442788 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357847 to: 357903 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427573 to: 427629 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427573 to: 427629 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12407 to: 12463 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502540 to: 502596 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1792 to: 1848 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356982 to: 357038 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124045 to: 1124101 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204238 to: 204294 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491978 to: 492034 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409958 to: 2410014 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240576 to: 3240632 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525806 to: 2525862 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507525 to: 507581 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 703 to: 759 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491980 to: 492036 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7799 to: 7855 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315504 to: 315560 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317320 to: 317376 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413443 to: 413499 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285135 to: 2285191 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233732 to: 233785 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172594 to: 2172650 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232457 to: 232510 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40490 to: 40543 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853437 to: 1853493 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419960 to: 1420016 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44986 to: 45042 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940387 to: 940440 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59265 to: 59318 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217944 to: 1217997 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301584 to: 301634 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085152 to: 1085205 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714398 to: 714451 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240623 to: 1240679 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12250 to: 12303 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6718 to: 6771 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514511 to: 1514567 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371597 to: 3371650 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446560 to: 1446613 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080843 to: 3080896 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765928 to: 2765984 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621798 to: 1621857 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301214 to: 301267 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968965 to: 969018 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887961 to: 888014 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241275 to: 2241334 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531376 to: 3531429 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218734 to: 2218793 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245241 to: 2245300 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832334 to: 832387 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63997 to: 64050 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177182 to: 177235 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46061 to: 46114 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695110 to: 2695163 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395217 to: 395267 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504466 to: 1504522 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202777 to: 3202830 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526149 to: 526202 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377059 to: 3377115 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482593 to: 4482643 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793822 to: 793875 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 580052 to: 580105 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261638 to: 4261688 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140982 to: 4141032 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169720 to: 5169770 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928879 to: 4928929 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578038 to: 578094 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612210 to: 2612263 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050228 to: 3050281 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2447 to: 2500 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2286 to: 2339 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101771 to: 2101824 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632437 to: 2632490 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921336 to: 2921386 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3095292 to: 3095342 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1940250 to: 1940300 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3116613 to: 3116663 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65813 to: 65863 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2541041 to: 2541091 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3284953 to: 3285003 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3268964 to: 3269014 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1189347 to: 1189397 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 300337 to: 300387 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2489654 to: 2489704 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3695018 to: 3695068 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3436216 to: 3436266 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1425818 to: 1425868 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463654 to: 1463710 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552688 to: 552738 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257754 to: 3257801 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2000685 to: 2000732 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3014553 to: 3014600 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 897289 to: 897336 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332683 to: 332739 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354691 to: 354747 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073458 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1923435 to: 1923482 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5244189 to: 5244236 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_111|beg|1111|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| cagTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaatgaaactcggccttgatctgcgtg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaa | |||
| Protein-Sequence | |||
| VEALGKDKIVALNLAPSTPYWLESIGAAPN | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 796115 to: 796198 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 277 to: 360 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 286825 to: 286908 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439869 to: 439952 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754816 to: 754899 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057554 to: 1057637 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617214 to: 617297 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205317 to: 2205400 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803832 to: 2803909 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267343 to: 1267423 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129709 to: 129792 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901370 to: 1901447 | |||
Coding-DNA |
|||
| agTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaa | |||
| Protein-Sequence | |||
| VEALGKDKIVALNLAPSTPYWLESIGAAPN | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 796115 to: 796198 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 277 to: 360 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 286825 to: 286908 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439869 to: 439952 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754816 to: 754899 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057554 to: 1057637 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617214 to: 617297 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205317 to: 2205400 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803832 to: 2803909 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267343 to: 1267423 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129709 to: 129792 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901370 to: 1901447 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_112|beg|1551|length|121|forward|gi | ||
| Query_DNA-Sequence | |||
| accgggtgaacgaacttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcg | |||
| Protein-Sequence | |||
| NLGVAEPLVQRQGATRIVVELPGVQDTARAKEILGA | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796565 to: 796669 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 727 to: 831 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287275 to: 287379 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058007 to: 1058111 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439395 to: 439499 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755373 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617771 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204947 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130263 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846948 to: 2847052 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401101 to: 401205 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110213 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275359 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56995 to: 57099 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170152 to: 1170256 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554055 to: 2554159 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461242 to: 461346 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492159 to: 492263 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512197 to: 3512301 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362707 to: 3362811 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882128 to: 2882232 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977773 to: 977877 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198270 to: 3198374 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274711 to: 3274815 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437446 to: 3437550 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650131 to: 2650235 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666524 to: 1666628 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444339 to: 444443 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551315 to: 3551419 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245202 to: 3245306 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683180 to: 1683284 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611752 to: 1611856 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504400 to: 1504504 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804210 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392068 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495857 to: 495961 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983705 to: 2983809 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051595 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124455 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636032 to: 1636136 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442750 to: 442854 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357969 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427591 to: 427695 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427591 to: 427695 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12425 to: 12529 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502558 to: 502662 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1810 to: 1914 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357104 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124167 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204256 to: 204360 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491996 to: 492100 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409892 to: 2409996 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525740 to: 2525844 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507543 to: 507647 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491998 to: 492102 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7817 to: 7921 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315438 to: 315542 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317442 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413461 to: 413565 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732226 to: 1732330 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803361 to: 2803465 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901814 to: 1901918 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285069 to: 2285173 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494517 to: 3494621 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729346 to: 2729450 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240510 to: 3240614 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695412 to: 2695516 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267897 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463672 to: 1463776 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235569 to: 1235673 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724819 to: 5724920 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332617 to: 332721 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153867 to: 1153971 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726031 to: 726135 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354709 to: 354813 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987105 to: 987206 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877775 to: 3877876 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420082 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055803 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1373 to: 1474 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8251 to: 8352 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1481 to: 1582 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514252 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972439 to: 972540 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269504 to: 269608 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388837 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555461 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279412 to: 3279513 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628528 to: 628632 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2109 to: 2219 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336960 to: 337064 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990396 to: 2990500 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940422 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218254 to: 5218355 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308608 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248375 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278117 to: 4278218 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556648 to: 1556752 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59196 to: 59300 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714416 to: 714520 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695041 to: 2695145 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597488 to: 4597592 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164619 to: 3164723 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145427 to: 1145531 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446491 to: 1446595 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301697 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531391 to: 3531492 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172713 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853371 to: 1853475 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371612 to: 3371713 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526086 to: 526187 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080858 to: 3080959 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232475 to: 232579 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301229 to: 301330 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533806 to: 533907 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887898 to: 887999 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832349 to: 832450 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169654 to: 5169755 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482527 to: 4482628 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261572 to: 4261673 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140916 to: 4141017 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968902 to: 969003 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202792 to: 3202893 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928813 to: 4928914 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317807 to: 4317908 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63934 to: 64035 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177119 to: 177220 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45998 to: 46099 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765865 to: 2765966 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40609 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514529 to: 1514630 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377077 to: 3377178 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921351 to: 2921452 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1334061 to: 1334162 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1539441 to: 1539542 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577975 to: 578076 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126061 to: 1126162 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621738 to: 1621839 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241215 to: 2241316 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44923 to: 45024 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218674 to: 2218775 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245181 to: 2245282 | |||
| gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 661706 to: 661774 | |||
| gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 332251 to: 332319 | |||
| gi-nr: gi|642362 gi_def: T.thermophilus nusA/infB operon DNA hsp_num: 1 from: 4529 to: 4594 | |||
Coding-DNA |
|||
| cttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcg | |||
| Protein-Sequence | |||
| NLGVAEPLVQRQGATRIVVELPGVQDTARAKEILGA | |||
| Hit-Information Section | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796565 to: 796669 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 727 to: 831 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287275 to: 287379 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058007 to: 1058111 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439395 to: 439499 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755373 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617771 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204947 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130263 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846948 to: 2847052 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401101 to: 401205 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110213 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275359 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56995 to: 57099 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170152 to: 1170256 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554055 to: 2554159 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461242 to: 461346 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492159 to: 492263 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512197 to: 3512301 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362707 to: 3362811 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882128 to: 2882232 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977773 to: 977877 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198270 to: 3198374 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274711 to: 3274815 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437446 to: 3437550 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650131 to: 2650235 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666524 to: 1666628 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444339 to: 444443 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551315 to: 3551419 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245202 to: 3245306 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683180 to: 1683284 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611752 to: 1611856 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504400 to: 1504504 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804210 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392068 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495857 to: 495961 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983705 to: 2983809 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051595 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124455 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636032 to: 1636136 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442750 to: 442854 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357969 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427591 to: 427695 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427591 to: 427695 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12425 to: 12529 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502558 to: 502662 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1810 to: 1914 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357104 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124167 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204256 to: 204360 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491996 to: 492100 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409892 to: 2409996 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525740 to: 2525844 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507543 to: 507647 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 721 to: 825 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491998 to: 492102 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7817 to: 7921 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315438 to: 315542 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317442 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413461 to: 413565 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732226 to: 1732330 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803361 to: 2803465 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901814 to: 1901918 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285069 to: 2285173 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494517 to: 3494621 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729346 to: 2729450 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240510 to: 3240614 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695412 to: 2695516 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267897 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463672 to: 1463776 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235569 to: 1235673 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724819 to: 5724920 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332617 to: 332721 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153867 to: 1153971 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726031 to: 726135 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354709 to: 354813 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987105 to: 987206 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877775 to: 3877876 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420082 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055803 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1373 to: 1474 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8251 to: 8352 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1481 to: 1582 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514252 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972439 to: 972540 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269504 to: 269608 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388837 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555461 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279412 to: 3279513 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628528 to: 628632 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2109 to: 2219 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336960 to: 337064 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990396 to: 2990500 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940422 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218254 to: 5218355 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308608 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248375 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278117 to: 4278218 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556648 to: 1556752 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59196 to: 59300 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714416 to: 714520 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695041 to: 2695145 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597488 to: 4597592 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164619 to: 3164723 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145427 to: 1145531 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446491 to: 1446595 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301697 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531391 to: 3531492 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172713 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853371 to: 1853475 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371612 to: 3371713 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526086 to: 526187 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080858 to: 3080959 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232475 to: 232579 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301229 to: 301330 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533806 to: 533907 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887898 to: 887999 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832349 to: 832450 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169654 to: 5169755 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482527 to: 4482628 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261572 to: 4261673 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140916 to: 4141017 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968902 to: 969003 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202792 to: 3202893 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928813 to: 4928914 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317807 to: 4317908 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63934 to: 64035 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177119 to: 177220 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45998 to: 46099 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765865 to: 2765966 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40609 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514529 to: 1514630 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377077 to: 3377178 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921351 to: 2921452 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1334061 to: 1334162 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1539441 to: 1539542 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577975 to: 578076 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126061 to: 1126162 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621738 to: 1621839 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241215 to: 2241316 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44923 to: 45024 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218674 to: 2218775 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245181 to: 2245282 | |||
| gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 661706 to: 661774 | |||
| gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 332251 to: 332319 | |||
| gi-nr: gi|642362 gi_def: T.thermophilus nusA/infB operon DNA hsp_num: 1 from: 4529 to: 4594 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_113|beg|1511|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| cgcaactacgccgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgacaTcgtatc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgac | |||
| Protein-Sequence | |||
| DVAPLALEPEAQATPSSFTRLRKIVVFCSTA | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287223 to: 287285 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796513 to: 796575 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 675 to: 737 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057955 to: 1058017 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439489 to: 439551 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755217 to: 755279 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617615 to: 617677 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130107 to: 130178 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204937 to: 2204999 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1170106 to: 1170162 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512291 to: 3512347 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198364 to: 3198420 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551409 to: 3551465 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 804060 to: 804116 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 675 to: 731 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2983799 to: 2983855 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051445 to: 1051501 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1124305 to: 1124361 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1124017 to: 1124073 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803455 to: 2803511 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901768 to: 1901824 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479930 to: 1479989 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 401055 to: 401111 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301550 to: 301606 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650225 to: 2650281 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332705 to: 332767 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726119 to: 726181 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269592 to: 269654 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395183 to: 395236 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853465 to: 1853521 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 2314 to: 2367 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 2 from: 2101743 to: 2101796 | |||
Coding-DNA |
|||
| cgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgac | |||
| Protein-Sequence | |||
| DVAPLALEPEAQATPSSFTRLRKIVVFCSTA | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287223 to: 287285 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796513 to: 796575 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 675 to: 737 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057955 to: 1058017 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439489 to: 439551 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755217 to: 755279 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617615 to: 617677 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130107 to: 130178 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204937 to: 2204999 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1170106 to: 1170162 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512291 to: 3512347 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198364 to: 3198420 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551409 to: 3551465 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 804060 to: 804116 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 675 to: 731 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2983799 to: 2983855 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051445 to: 1051501 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1124305 to: 1124361 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1124017 to: 1124073 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803455 to: 2803511 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901768 to: 1901824 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479930 to: 1479989 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 401055 to: 401111 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301550 to: 301606 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650225 to: 2650281 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332705 to: 332767 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726119 to: 726181 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269592 to: 269654 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395183 to: 395236 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853465 to: 1853521 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 2314 to: 2367 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 2 from: 2101743 to: 2101796 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_115|beg|1360|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| ggttgaagtgaccctgcgtgatgccgagcagcttgcgcaaactaagctgcttctggagTtcgaaacaTccgtgatatgacctttacgacttcagaatccgatggccgttt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_119|beg|1626|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| cgggtgtacaagatacagcgTcTgtgctaaagaaatcttaggcgcgaccgcTaacccttgaatttTcgtgaagtggacgTataaagcgaccttgccgctgcggcagcaggacgtgcgcctgctg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_120|beg|1816|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| aagcatttaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggTtgaacatttcgctcgTatagcgaaggcgcaacaaatgtcagcgttctcgaaaaagaaca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_121|beg|794|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaggtacgcTtgaaatctctttaaaacagccataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgcacttcca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgca | |||
| Protein-Sequence | |||
| HRILAVLNRYPLWKYLMVMLTIAVAALYA | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440151 to: 440273 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754495 to: 754617 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555925 to: 1556005 | |||
Coding-DNA |
|||
| ataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgca | |||
| Protein-Sequence | |||
| HRILAVLNRYPLWKYLMVMLTIAVAALYA | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440151 to: 440273 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754495 to: 754617 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555925 to: 1556005 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_124|beg|1159|length|123|forward|gi | ||
| Query_DNA-Sequence | |||
| ttcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtcag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtc | |||
| Protein-Sequence | |||
| FNAILAKSIGAAPMKLGLDLRGGVHFLMEVGYGCRDGKIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754879 to: 754950 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439818 to: 439889 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129772 to: 129843 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205266 to: 2205334 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285483 to: 2285554 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4144619 to: 4144687 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729837 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597911 to: 4597979 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803781 to: 2803852 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 3 from: 1803433 to: 1803498 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1182999 to: 1183070 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109734 to: 1109799 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 1144386 to: 1144454 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479601 to: 1479672 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267403 to: 1267474 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650551 to: 2650622 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 3001931 to: 3001996 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169777 to: 1169842 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057617 to: 1057688 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617277 to: 617348 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394842 to: 394913 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376690 to: 3376761 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901427 to: 1901498 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 2890258 to: 2890323 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635645 to: 1635716 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578392 to: 578463 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279829 to: 3279900 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40130 to: 40195 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6361 to: 6432 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695535 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766350 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534294 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 343 to: 411 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11893 to: 11964 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628150 to: 628215 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126481 to: 1126552 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154281 to: 1154349 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2523 to: 2591 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1823587 to: 1823652 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556270 to: 1556338 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463294 to: 1463362 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622152 to: 1622223 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241629 to: 2241700 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219088 to: 2219159 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245595 to: 2245666 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504814 to: 1504882 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940797 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145049 to: 1145117 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 333031 to: 333093 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726445 to: 726507 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354337 to: 354399 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235194 to: 1235259 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269918 to: 269980 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59675 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371249 to: 3371308 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080495 to: 3080554 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793468 to: 793533 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 579698 to: 579763 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637094 to: 637159 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190327 to: 190392 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888315 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64351 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177536 to: 177589 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46415 to: 46468 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073815 | |||
| gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1335660 to: 1335725 | |||
| gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 798703 to: 798768 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 4 from: 192541 to: 192573 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12619 | |||
Coding-DNA |
|||
| tcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtc | |||
| Protein-Sequence | |||
| FNAILAKSIGAAPMKLGLDLRGGVHFLMEVGYGCRDGKIGQ | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754879 to: 754950 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439818 to: 439889 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129772 to: 129843 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205266 to: 2205334 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285483 to: 2285554 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4144619 to: 4144687 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729837 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597911 to: 4597979 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803781 to: 2803852 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 3 from: 1803433 to: 1803498 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1182999 to: 1183070 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109734 to: 1109799 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 1144386 to: 1144454 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479601 to: 1479672 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267403 to: 1267474 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650551 to: 2650622 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 3001931 to: 3001996 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169777 to: 1169842 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057617 to: 1057688 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617277 to: 617348 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394842 to: 394913 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376690 to: 3376761 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901427 to: 1901498 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 2890258 to: 2890323 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635645 to: 1635716 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578392 to: 578463 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279829 to: 3279900 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40130 to: 40195 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6361 to: 6432 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695535 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766350 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534294 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 343 to: 411 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11893 to: 11964 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628150 to: 628215 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126481 to: 1126552 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154281 to: 1154349 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2523 to: 2591 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1823587 to: 1823652 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556270 to: 1556338 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463294 to: 1463362 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622152 to: 1622223 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241629 to: 2241700 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219088 to: 2219159 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245595 to: 2245666 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504814 to: 1504882 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940797 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145049 to: 1145117 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 333031 to: 333093 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726445 to: 726507 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354337 to: 354399 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235194 to: 1235259 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269918 to: 269980 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59675 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371249 to: 3371308 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080495 to: 3080554 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793468 to: 793533 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 579698 to: 579763 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637094 to: 637159 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190327 to: 190392 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888315 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64351 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177536 to: 177589 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46415 to: 46468 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073815 | |||
| gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1335660 to: 1335725 | |||
| gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 798703 to: 798768 | |||
| gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 4 from: 192541 to: 192573 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12619 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_126|beg|1092|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tcagcgccccgagaTtatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaaTcgccatattggctagagTtcaattggtgctgcaccaat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cagcgccccgagaTtatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaaT | |||
| Protein-Sequence | |||
| QRPEIIISEALGKDKIVALNLAPSI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057545 to: 1057601 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439905 to: 439961 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754807 to: 754863 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617205 to: 617261 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205356 to: 2205409 | |||
Coding-DNA |
|||
| atcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaaT | |||
| Protein-Sequence | |||
| MAIEGARFNATILSLPNASLMI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057544 to: 1057603 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439903 to: 439959 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754809 to: 754865 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617207 to: 617263 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_128|beg|2104|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| tgctctgctattgcgtgccggTtgctttgattgcgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gctctgctattgcgtgccggTtgctttgattgcgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtatt | |||
| Protein-Sequence | |||
| LCYCVPVALIAPISIVEERTIGPSMGQQNIDMGI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058568 to: 1058648 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438858 to: 438938 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755830 to: 755910 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618228 to: 618308 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130720 to: 130800 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204306 to: 2204386 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802824 to: 2802904 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902375 to: 1902455 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284538 to: 2284615 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694875 to: 2694955 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728812 to: 2728892 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667082 to: 1667162 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683738 to: 1683818 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392525 to: 392605 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 358426 to: 358506 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357561 to: 357641 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492557 to: 492637 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492559 to: 492639 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 314901 to: 314981 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 414022 to: 414102 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694501 to: 2694578 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239976 to: 3240056 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824544 to: 1824624 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553288 to: 553368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63433 to: 63510 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176618 to: 176695 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45497 to: 45574 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 1 to: 42 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_129|beg|950|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| acagggcgcgtggcgcctctgtttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaagcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacgga | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacg | |||
| Protein-Sequence | |||
| SATSPKNPLLLKMAQSLFVSMIR | |||
| Hit-Information Section | |||
Coding-DNA |
|||
| gcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacg | |||
| Protein-Sequence | |||
| SATSPKNPLLLKMAQSLFVSMIR | |||
| Hit-Information Section | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_131|beg|675|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| ctggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaTcgaagttgtgatcaagaaggacTttcgtgactgcag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaT | |||
| Protein-Sequence | |||
| GGLVGRITKIAEDNAYITIELNTNN | |||
| Hit-Information Section | |||
| gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 4 from: 193 to: 267 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 286387 to: 286461 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 795677 to: 795751 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616776 to: 616850 | |||
Coding-DNA |
|||
| tggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaT | |||
| Protein-Sequence | |||
| GGLVGRITKIAEDNAYITIELNTNN | |||
| Hit-Information Section | |||
| gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 4 from: 193 to: 267 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 286387 to: 286461 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 795677 to: 795751 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616776 to: 616850 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_136|beg|177|length|143|forward|gi | ||
| Query_DNA-Sequence | |||
| tcgaagtcatacctgcatTcatctggatcgctgtaacgaaatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaa | |||
| Protein-Sequence | |||
| RNPRCTLELLSITCVTTNALMESIRKAIDEDRFDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 753961 to: 754008 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 440760 to: 440807 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056639 to: 1056686 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616314 to: 616361 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 128940 to: 128984 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1554524 to: 1554568 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393430 to: 2393477 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 1024 to: 1071 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1102 to: 1149 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091059 to: 1091106 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825578 to: 825625 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829234 to: 829281 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130119 to: 1130166 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130070 to: 1130117 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827333 to: 827380 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161428 to: 1161469 | |||
| gi-nr: gi|156720437 gi_def: Uncultured crenarchaeote amoA gene for ammonia monooxygenase subunit A, partial cds, clone: DGGE_AOA_6 hsp_num: 1 from: 99 to: 164 | |||
Coding-DNA |
|||
| aatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaa | |||
| Protein-Sequence | |||
| RNPRCTLELLSITCVTTNALMESIRKAIDEDRFDQ | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 753961 to: 754008 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 440760 to: 440807 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056639 to: 1056686 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616314 to: 616361 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 128940 to: 128984 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1554524 to: 1554568 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393430 to: 2393477 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 1024 to: 1071 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1102 to: 1149 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091059 to: 1091106 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825578 to: 825625 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829234 to: 829281 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130119 to: 1130166 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130070 to: 1130117 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827333 to: 827380 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161428 to: 1161469 | |||
| gi-nr: gi|156720437 gi_def: Uncultured crenarchaeote amoA gene for ammonia monooxygenase subunit A, partial cds, clone: DGGE_AOA_6 hsp_num: 1 from: 99 to: 164 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_137|beg|2435|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| gagctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgct | |||
| Protein-Sequence | |||
| SLLRNGKNPQQAIHQGYR*R | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1600 to: 1644 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288148 to: 288192 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204074 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618540 to: 618584 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058880 to: 1058924 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 278 to: 322 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284259 to: 2284291 | |||
Coding-DNA |
|||
| attcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtac | |||
| Protein-Sequence | |||
| RIQYHCRCQHHHLNYGDHFVCRWY | |||
| Hit-Information Section | |||
| gi-nr: gi|109464452 gi_def: PREDICTED: Rattus norvegicus complement component 7 (C7), mRNA hsp_num: 2 from: 2043 to: 2069 | |||
| gi-nr: gi|24580364 gi_def: Homo sapiens chromosome 16 clone CTD-3032L3, complete sequence hsp_num: 1 from: 43502 to: 43528 | |||
| gi-nr: gi|57900987 gi_def: Mus musculus chromosome 7, clone RP23-449M8, complete sequence hsp_num: 1 from: 59943 to: 59975 | |||
Coding-DNA |
|||
| agctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgct | |||
| Protein-Sequence | |||
| SLLRNGKNPQQAIHQGYR*R | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1600 to: 1644 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288148 to: 288192 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204074 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618540 to: 618584 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058880 to: 1058924 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 278 to: 322 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284259 to: 2284291 | |||
Coding-DNA |
|||
| attcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtac | |||
| Protein-Sequence | |||
| RIQYHCRCQHHHLNYGDHFVCRWY | |||
| Hit-Information Section | |||
| gi-nr: gi|109464452 gi_def: PREDICTED: Rattus norvegicus complement component 7 (C7), mRNA hsp_num: 2 from: 2043 to: 2069 | |||
| gi-nr: gi|24580364 gi_def: Homo sapiens chromosome 16 clone CTD-3032L3, complete sequence hsp_num: 1 from: 43502 to: 43528 | |||
| gi-nr: gi|57900987 gi_def: Mus musculus chromosome 7, clone RP23-449M8, complete sequence hsp_num: 1 from: 59943 to: 59975 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_138|beg|1224|length|120|forward|gi | ||
| Query_DNA-Sequence | |||
| gtggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgTcgtgTacgagaaaaattcgttaccgcgcgat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctg | |||
| Protein-Sequence | |||
| WCALPMEVDMDAAMEKLVSQQEEAFRSDL | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439755 to: 439826 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754942 to: 755013 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057680 to: 1057751 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617340 to: 617411 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129835 to: 129906 | |||
Coding-DNA |
|||
| tggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctg | |||
| Protein-Sequence | |||
| WCALPMEVDMDAAMEKLVSQQEEAFRSDL | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439755 to: 439826 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754942 to: 755013 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057680 to: 1057751 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617340 to: 617411 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129835 to: 129906 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_141|beg|1769|length|135|forward|gi | ||
| Query_DNA-Sequence | |||
| aatTggtTcgcctgtggtgctgTaaaaagcgcgtgaTttctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaTggtgaacattttcgctcgatagcgaaggcggcaaca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atTggtTcgcctgtggtgctgTaaaaagcgcgtgaTttctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgc | |||
| Protein-Sequence | |||
| GRPYSSALELASVMLEPPRNHALFTAPQANQ | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204652 to: 2204708 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058246 to: 1058305 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130398 to: 130454 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617906 to: 617962 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_143|beg|2118|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggggtatggttggcggt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaa | |||
| Protein-Sequence | |||
| IDGPMVRSSDDRNWRNQSTG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 1314 to: 1385 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058594 to: 1058665 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 287862 to: 287933 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797152 to: 797223 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438841 to: 438912 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 755856 to: 755927 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204289 to: 2204360 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618254 to: 618325 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 5 from: 3 to: 41 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125504 to: 1125554 | |||
Coding-DNA |
|||
| tgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaa | |||
| Protein-Sequence | |||
| IDGPMVRSSDDRNWRNQSTG | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 1314 to: 1385 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058594 to: 1058665 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 287862 to: 287933 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797152 to: 797223 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438841 to: 438912 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 755856 to: 755927 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204289 to: 2204360 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618254 to: 618325 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 5 from: 3 to: 41 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125504 to: 1125554 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_145|beg|2338|length|126|forward|gi | ||
| Query_DNA-Sequence | |||
| gggcgcaaccatgaccttgccgggtattgctggtatcgtTgttgacgggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaatcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaa | |||
| Protein-Sequence | |||
| RVGMVWSDANVLIFERIREDATRRKK | |||
| Hit-Information Section | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553561 to: 553608 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 239 to: 277 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 4 from: 1902648 to: 1902686 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058841 to: 1058879 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756103 to: 756141 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618501 to: 618539 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438627 to: 438665 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204075 to: 2204113 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130993 to: 131031 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694629 to: 2694682 | |||
| gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 2 from: 1636 to: 1674 | |||
| gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 2 from: 1714 to: 1752 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2802593 to: 2802631 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3165447 to: 3165485 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 337797 to: 337835 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 2 from: 62953 to: 62991 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 1869566 to: 1869604 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1996463 to: 1996501 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1156305 to: 1156343 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1085939 to: 1085977 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 830708 to: 830746 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 834364 to: 834402 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1125000 to: 1125038 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1124951 to: 1124989 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 832463 to: 832501 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44724 to: 44762 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069482 to: 1069520 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125272 to: 1125310 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428793 to: 1428831 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724042 to: 5724080 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1309347 to: 1309385 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1249114 to: 1249152 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 2 from: 5217474 to: 5217512 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556200 to: 1556238 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4277340 to: 4277378 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 973276 to: 973314 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389576 to: 1389614 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987942 to: 987980 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1056539 to: 1056577 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 2 from: 3876998 to: 3877036 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 2169268 to: 2169306 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1503629 to: 1503667 | |||
| gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 2 from: 1591 to: 1629 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244278 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 2 from: 209332 to: 209373 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 596 to: 634 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 7474 to: 7512 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 896500 to: 896538 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 2 from: 2695339 to: 2695377 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 704 to: 742 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1922646 to: 1922684 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1920622 to: 1920660 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887341 to: 2887379 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883604 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694270 to: 2694308 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636808 to: 1636855 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445717 to: 1445755 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356905 to: 356943 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153096 to: 1153134 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1557485 to: 1557523 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480813 to: 1480851 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333272 to: 1333310 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540293 to: 1540331 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 2 from: 673411 to: 673449 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824814 to: 1824852 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924362 to: 1924400 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596735 to: 4596773 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994321 to: 1994359 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268621 to: 1268659 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941628 to: 941666 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620964 to: 1621002 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244407 to: 2244445 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240441 to: 2240479 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217900 to: 2217938 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420821 to: 1420859 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841183 to: 1841221 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 72044 to: 72082 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852600 to: 1852638 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217107 to: 1217145 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084315 to: 1084353 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331846 to: 331884 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725260 to: 725298 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268733 to: 268771 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355545 to: 355583 | |||
| gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 2 from: 1261 to: 1299 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072565 to: 1072603 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939544 to: 939582 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377959 to: 3377997 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 577156 to: 577194 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1338 to: 1376 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994965 to: 3995003 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278635 to: 3278673 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709778 to: 1709816 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 5243400 to: 5243438 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618779 to: 4618817 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224469 to: 4224507 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3013761 to: 3013799 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 3256965 to: 3257003 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244437 to: 3244475 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145547 to: 1145582 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 2001483 to: 2001521 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 2 from: 2056492 to: 2056533 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 1939464 to: 1939502 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65027 to: 65065 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1546 to: 1581 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3115827 to: 3115865 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534114 to: 1534152 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3094506 to: 3094544 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905662 to: 905700 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 2 from: 1017561 to: 1017599 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 2 from: 745417 to: 745455 | |||
| gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190686 to: 190724 | |||
| gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 2 from: 44770 to: 44808 | |||
| gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 2 from: 144117 to: 144155 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745849 to: 7745887 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401997 to: 2402035 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183384 to: 183422 | |||
| gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 2 from: 8465 to: 8503 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122460 to: 122498 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834634 to: 1834672 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 4 from: 3000800 to: 3000835 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131764 to: 2131802 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476987 to: 1477025 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143857 to: 143895 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 234584 to: 234622 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 2 from: 401537 to: 401572 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 233309 to: 233347 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650961 to: 1650996 | |||
| gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358106 to: 1358144 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 2 from: 1208203 to: 1208238 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 2 from: 1268936 to: 1268971 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492802 to: 1492837 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692405 to: 692440 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631895 to: 631930 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156360 to: 156395 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081115 to: 1081153 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10477 to: 10515 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13862 to: 13900 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 2 from: 1610 to: 1648 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 1449 to: 1487 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629540 to: 1629575 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598146 to: 1598181 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560684 to: 1560719 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572088 to: 572123 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152867 to: 1152902 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026518 to: 1026553 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043489 to: 1043524 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029103 to: 1029138 | |||
| gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4498 to: 4536 | |||
| gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521326 to: 2521364 | |||
| gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553776 to: 2553814 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 2 from: 734897 to: 734932 | |||
| gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 2 from: 233401 to: 233436 | |||
| gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438197 to: 2438235 | |||
| gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224723 to: 2224761 | |||
| gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107227 to: 2107265 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877871 to: 877909 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824167 to: 824205 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715250 to: 715288 | |||
| gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048803 to: 1048841 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575587 to: 1575622 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415154 to: 2415192 | |||
Coding-DNA |
|||
| ggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaa | |||
| Protein-Sequence | |||
| RVGMVWSDANVLIFERIREDATRRKK | |||
| Hit-Information Section | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553561 to: 553608 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 239 to: 277 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 4 from: 1902648 to: 1902686 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058841 to: 1058879 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756103 to: 756141 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618501 to: 618539 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438627 to: 438665 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204075 to: 2204113 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130993 to: 131031 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694629 to: 2694682 | |||
| gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 2 from: 1636 to: 1674 | |||
| gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 2 from: 1714 to: 1752 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2802593 to: 2802631 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3165447 to: 3165485 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 337797 to: 337835 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 2 from: 62953 to: 62991 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 1869566 to: 1869604 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1996463 to: 1996501 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1156305 to: 1156343 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1085939 to: 1085977 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 830708 to: 830746 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 834364 to: 834402 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1125000 to: 1125038 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1124951 to: 1124989 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 832463 to: 832501 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44724 to: 44762 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069482 to: 1069520 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125272 to: 1125310 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428793 to: 1428831 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724042 to: 5724080 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1309347 to: 1309385 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1249114 to: 1249152 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 2 from: 5217474 to: 5217512 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556200 to: 1556238 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4277340 to: 4277378 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 973276 to: 973314 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389576 to: 1389614 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987942 to: 987980 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1056539 to: 1056577 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 2 from: 3876998 to: 3877036 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 2169268 to: 2169306 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1503629 to: 1503667 | |||
| gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 2 from: 1591 to: 1629 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244278 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 2 from: 209332 to: 209373 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 596 to: 634 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 7474 to: 7512 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 896500 to: 896538 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 2 from: 2695339 to: 2695377 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 704 to: 742 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1922646 to: 1922684 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1920622 to: 1920660 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887341 to: 2887379 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883604 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694270 to: 2694308 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636808 to: 1636855 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445717 to: 1445755 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356905 to: 356943 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153096 to: 1153134 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1557485 to: 1557523 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480813 to: 1480851 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333272 to: 1333310 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540293 to: 1540331 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 2 from: 673411 to: 673449 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824814 to: 1824852 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924362 to: 1924400 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596735 to: 4596773 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994321 to: 1994359 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268621 to: 1268659 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941628 to: 941666 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620964 to: 1621002 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244407 to: 2244445 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240441 to: 2240479 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217900 to: 2217938 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420821 to: 1420859 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841183 to: 1841221 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 72044 to: 72082 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852600 to: 1852638 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217107 to: 1217145 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084315 to: 1084353 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331846 to: 331884 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725260 to: 725298 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268733 to: 268771 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355545 to: 355583 | |||
| gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 2 from: 1261 to: 1299 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072565 to: 1072603 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939544 to: 939582 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377959 to: 3377997 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 577156 to: 577194 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1338 to: 1376 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994965 to: 3995003 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278635 to: 3278673 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709778 to: 1709816 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 5243400 to: 5243438 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618779 to: 4618817 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224469 to: 4224507 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3013761 to: 3013799 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 3256965 to: 3257003 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244437 to: 3244475 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145547 to: 1145582 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 2001483 to: 2001521 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 2 from: 2056492 to: 2056533 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 1939464 to: 1939502 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65027 to: 65065 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1546 to: 1581 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3115827 to: 3115865 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534114 to: 1534152 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3094506 to: 3094544 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905662 to: 905700 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 2 from: 1017561 to: 1017599 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 2 from: 745417 to: 745455 | |||
| gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190686 to: 190724 | |||
| gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 2 from: 44770 to: 44808 | |||
| gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 2 from: 144117 to: 144155 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745849 to: 7745887 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401997 to: 2402035 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183384 to: 183422 | |||
| gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 2 from: 8465 to: 8503 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122460 to: 122498 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834634 to: 1834672 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 4 from: 3000800 to: 3000835 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131764 to: 2131802 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476987 to: 1477025 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143857 to: 143895 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 234584 to: 234622 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 2 from: 401537 to: 401572 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 233309 to: 233347 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650961 to: 1650996 | |||
| gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358106 to: 1358144 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 2 from: 1208203 to: 1208238 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 2 from: 1268936 to: 1268971 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492802 to: 1492837 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692405 to: 692440 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631895 to: 631930 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156360 to: 156395 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081115 to: 1081153 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10477 to: 10515 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13862 to: 13900 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 2 from: 1610 to: 1648 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 1449 to: 1487 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629540 to: 1629575 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598146 to: 1598181 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560684 to: 1560719 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572088 to: 572123 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152867 to: 1152902 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026518 to: 1026553 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043489 to: 1043524 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029103 to: 1029138 | |||
| gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4498 to: 4536 | |||
| gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521326 to: 2521364 | |||
| gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553776 to: 2553814 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 2 from: 734897 to: 734932 | |||
| gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 2 from: 233401 to: 233436 | |||
| gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438197 to: 2438235 | |||
| gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224723 to: 2224761 | |||
| gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107227 to: 2107265 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877871 to: 877909 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824167 to: 824205 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715250 to: 715288 | |||
| gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048803 to: 1048841 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575587 to: 1575622 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415154 to: 2415192 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_146|beg|622|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatTcgagTttgaacaccaacaacgaagttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagata | |||
| Protein-Sequence | |||
| LSSAILVIRPTRPPEVNTSSPLPRSHQVLCS | |||
| Hit-Information Section | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3513152 to: 3513214 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3199225 to: 3199287 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3552270 to: 3552332 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803193 to: 803255 | |||
| gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 2 from: 237 to: 299 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984660 to: 2984722 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1050578 to: 1050640 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123438 to: 1123500 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123150 to: 1123212 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169241 to: 1169303 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460332 to: 460391 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 491249 to: 491308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847903 to: 2847962 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443429 to: 443488 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 391054 to: 391113 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494947 to: 495006 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441840 to: 441899 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356955 to: 357014 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426681 to: 426740 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426681 to: 426740 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501648 to: 501707 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 482 to: 541 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 900 to: 959 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 356090 to: 356149 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 491086 to: 491145 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 491088 to: 491147 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6907 to: 6966 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316393 to: 316452 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316428 to: 316487 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412551 to: 412610 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1535 to: 1594 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1536 to: 1595 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 2555010 to: 2555066 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 400192 to: 400251 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274342 to: 1274404 | |||
| gi-nr: gi|15375120 gi_def: Homo sapiens chromosome 5 clone CTC-345M13, complete sequence hsp_num: 3 from: 16079 to: 16111 | |||
| gi-nr: gi|28827861 gi_def: Homo sapiens chromosome 5 clone RP11-639O24, complete sequence hsp_num: 3 from: 101163 to: 101195 | |||
| gi-nr: gi|28626633 gi_def: Homo sapiens chromosome 5 clone RP11-826N14, complete sequence hsp_num: 3 from: 125645 to: 125677 | |||
| gi-nr: gi|29569240 gi_def: Homo sapiens chromosome 5 clone RP11-1026M7, complete sequence hsp_num: 3 from: 60757 to: 60789 | |||
| gi-nr: gi|156086979 gi_def: Babesia bovis hypothetical protein (BBOV_IV009750) mRNA, complete cds hsp_num: 1 from: 26 to: 58 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 511714 to: 511773 | |||
| gi-nr: gi|3046306 gi_def: Homo sapiens BAC clone CTA-459N13 from 7, complete sequence hsp_num: 2 from: 32424 to: 32456 | |||
| gi-nr: gi|90075875 gi_def: Macaca fascicularis brain cDNA clone: QmoA-11424, similar to human retinol dehydrogenase 11 (all-trans and 9-cis) (RDH11), mRNA, RefSeq: NM_016026.2 hsp_num: 2 from: 1573 to: 1605 | |||
| gi-nr: gi|154240756 gi_def: Macaca mulatta BAC CH250-65J15 () complete sequence hsp_num: 2 from: 26956 to: 26988 | |||
| gi-nr: gi|77681789 gi_def: Colobus guereza clone CH272-362P12, complete sequence hsp_num: 2 from: 39823 to: 39855 | |||
Coding-DNA |
|||
| agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagata | |||
| Protein-Sequence | |||
| LSSAILVIRPTRPPEVNTSSPLPRSHQVLCS | |||
| Hit-Information Section | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3513152 to: 3513214 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3199225 to: 3199287 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3552270 to: 3552332 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803193 to: 803255 | |||
| gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 2 from: 237 to: 299 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984660 to: 2984722 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1050578 to: 1050640 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123438 to: 1123500 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123150 to: 1123212 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169241 to: 1169303 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460332 to: 460391 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 491249 to: 491308 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847903 to: 2847962 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443429 to: 443488 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 391054 to: 391113 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494947 to: 495006 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441840 to: 441899 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356955 to: 357014 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426681 to: 426740 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426681 to: 426740 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501648 to: 501707 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 482 to: 541 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 900 to: 959 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 356090 to: 356149 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 491086 to: 491145 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 491088 to: 491147 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6907 to: 6966 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316393 to: 316452 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316428 to: 316487 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412551 to: 412610 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1535 to: 1594 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1536 to: 1595 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 2555010 to: 2555066 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 400192 to: 400251 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274342 to: 1274404 | |||
| gi-nr: gi|15375120 gi_def: Homo sapiens chromosome 5 clone CTC-345M13, complete sequence hsp_num: 3 from: 16079 to: 16111 | |||
| gi-nr: gi|28827861 gi_def: Homo sapiens chromosome 5 clone RP11-639O24, complete sequence hsp_num: 3 from: 101163 to: 101195 | |||
| gi-nr: gi|28626633 gi_def: Homo sapiens chromosome 5 clone RP11-826N14, complete sequence hsp_num: 3 from: 125645 to: 125677 | |||
| gi-nr: gi|29569240 gi_def: Homo sapiens chromosome 5 clone RP11-1026M7, complete sequence hsp_num: 3 from: 60757 to: 60789 | |||
| gi-nr: gi|156086979 gi_def: Babesia bovis hypothetical protein (BBOV_IV009750) mRNA, complete cds hsp_num: 1 from: 26 to: 58 | |||
| gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 511714 to: 511773 | |||
| gi-nr: gi|3046306 gi_def: Homo sapiens BAC clone CTA-459N13 from 7, complete sequence hsp_num: 2 from: 32424 to: 32456 | |||
| gi-nr: gi|90075875 gi_def: Macaca fascicularis brain cDNA clone: QmoA-11424, similar to human retinol dehydrogenase 11 (all-trans and 9-cis) (RDH11), mRNA, RefSeq: NM_016026.2 hsp_num: 2 from: 1573 to: 1605 | |||
| gi-nr: gi|154240756 gi_def: Macaca mulatta BAC CH250-65J15 () complete sequence hsp_num: 2 from: 26956 to: 26988 | |||
| gi-nr: gi|77681789 gi_def: Colobus guereza clone CH272-362P12, complete sequence hsp_num: 2 from: 39823 to: 39855 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_150|beg|2054|length|140|forward|gi | ||
| Query_DNA-Sequence | |||
| cgtaacttTccgtattactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcag | |||
| Protein-Sequence | |||
| LLGLISPEKRITFALLLRAGALIAPIFYRRRAHHWSINGSAE | |||
| Hit-Information Section | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284598 to: 2284636 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2728875 to: 2728919 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362236 to: 3362274 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274240 to: 3274278 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667061 to: 1667099 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240039 to: 3240077 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683717 to: 1683755 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732763 to: 1732801 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612289 to: 1612327 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881657 to: 2881695 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649660 to: 2649698 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244731 to: 3244775 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494046 to: 3494084 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1636569 to: 1636607 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153390 to: 1153428 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 2 from: 1515027 to: 1515065 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 2 from: 1241139 to: 1241177 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65318 to: 65356 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 960878 to: 960916 | |||
| gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 2 from: 1283075 to: 1283113 | |||
| gi-nr: gi|157129741 gi_def: Aedes aegypti hypothetical protein (AaeL_AAEL011574) mRNA, complete cds hsp_num: 1 from: 29 to: 70 | |||
Coding-DNA |
|||
| tactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcag | |||
| Protein-Sequence | |||
| LLGLISPEKRITFALLLRAGALIAPIFYRRRAHHWSINGSAE | |||
| Hit-Information Section | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284598 to: 2284636 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2728875 to: 2728919 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362236 to: 3362274 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274240 to: 3274278 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667061 to: 1667099 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240039 to: 3240077 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683717 to: 1683755 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732763 to: 1732801 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612289 to: 1612327 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881657 to: 2881695 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649660 to: 2649698 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244731 to: 3244775 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494046 to: 3494084 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1636569 to: 1636607 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153390 to: 1153428 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 2 from: 1515027 to: 1515065 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 2 from: 1241139 to: 1241177 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65318 to: 65356 | |||
| gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 960878 to: 960916 | |||
| gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 2 from: 1283075 to: 1283113 | |||
| gi-nr: gi|157129741 gi_def: Aedes aegypti hypothetical protein (AaeL_AAEL011574) mRNA, complete cds hsp_num: 1 from: 29 to: 70 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_154|beg|1304|length|122|forward|gi | ||
| Query_DNA-Sequence | |||
| agtgatctgcgtTgacgagaaaattcgttaccgcgcgatcccgtccattatcggatgcggttgaagtgacccctgcTgtgatgccgagcagcttgcgcaaactaagctgcttctggagtcga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_156|beg|1155|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| ctccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcgatggaaaaattggtc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcga | |||
| Protein-Sequence | |||
| PSRLYWLESIGAAPMKLGLDLRGGVHFLDGSGYGLPR | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129766 to: 129834 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439827 to: 439910 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754858 to: 754941 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803790 to: 2803873 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901406 to: 1901489 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617256 to: 617339 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057596 to: 1057679 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205275 to: 2205343 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 3306760 to: 3306828 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1203686 to: 1203754 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267382 to: 1267465 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1190601 to: 1190669 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1245355 to: 1245423 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1182993 to: 1183061 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285492 to: 2285575 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245631 to: 3245714 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376669 to: 3376752 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766291 to: 2766374 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1218292 to: 1218360 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40103 to: 40186 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085500 to: 1085568 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3878201 to: 3878269 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055309 to: 1055377 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552313 to: 552381 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534232 to: 534300 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622161 to: 1622244 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241638 to: 2241721 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219097 to: 2219180 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245604 to: 2245687 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628138 to: 628206 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695473 to: 2695556 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419582 to: 1419650 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126490 to: 1126558 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6355 to: 6423 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940738 to: 940821 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 969331 to: 969399 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11887 to: 11955 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 300836 to: 300904 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 45337 to: 45405 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868880 to: 1868948 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 693551 to: 693619 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 633041 to: 633109 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 367 to: 435 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446917 to: 1446982 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793456 to: 793521 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 2 from: 888324 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 2 from: 64360 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 2 from: 177545 to: 177589 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 2 from: 46424 to: 46468 | |||
| gi-nr: gi|5353753 gi_def: Mus musculus damage-specific DNA binding protein 1 (DDB1) mRNA, complete cds hsp_num: 1 from: 3961 to: 3987 | |||
| gi-nr: gi|16197725 gi_def: Mus musculus mRNA for damaged-DNA recognition protein 1 (Ddb1 gene) hsp_num: 1 from: 3993 to: 4019 | |||
| gi-nr: gi|16307147 gi_def: Mus musculus damage specific DNA binding protein 1, mRNA (cDNA clone MGC:6603 IMAGE:3487617), complete cds hsp_num: 1 from: 4008 to: 4034 | |||
| gi-nr: gi|74178493 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630016N21 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4027 to: 4053 | |||
| gi-nr: gi|74215028 gi_def: Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730320K18 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4041 to: 4067 | |||
| gi-nr: gi|74138854 gi_def: Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length enriched library, clone:I920020C16 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4059 to: 4085 | |||
| gi-nr: gi|74196165 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630116E15 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4082 to: 4108 | |||
| gi-nr: gi|74182144 gi_def: Mus musculus activated spleen cDNA, RIKEN full-length enriched library, clone:F830219B01 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4081 to: 4107 | |||
Coding-DNA |
|||
| tccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcga | |||
| Protein-Sequence | |||
| PSRLYWLESIGAAPMKLGLDLRGGVHFLDGSGYGLPR | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129766 to: 129834 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439827 to: 439910 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754858 to: 754941 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803790 to: 2803873 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901406 to: 1901489 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617256 to: 617339 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057596 to: 1057679 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205275 to: 2205343 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 3306760 to: 3306828 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1203686 to: 1203754 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267382 to: 1267465 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1190601 to: 1190669 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1245355 to: 1245423 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1182993 to: 1183061 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285492 to: 2285575 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245631 to: 3245714 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376669 to: 3376752 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766291 to: 2766374 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1218292 to: 1218360 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40103 to: 40186 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085500 to: 1085568 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3878201 to: 3878269 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055309 to: 1055377 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552313 to: 552381 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534232 to: 534300 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622161 to: 1622244 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241638 to: 2241721 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219097 to: 2219180 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245604 to: 2245687 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628138 to: 628206 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695473 to: 2695556 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419582 to: 1419650 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126490 to: 1126558 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6355 to: 6423 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940738 to: 940821 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 969331 to: 969399 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11887 to: 11955 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 300836 to: 300904 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 45337 to: 45405 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868880 to: 1868948 | |||
| gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 693551 to: 693619 | |||
| gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 633041 to: 633109 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 367 to: 435 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446917 to: 1446982 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793456 to: 793521 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 2 from: 888324 to: 888368 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 2 from: 64360 to: 64404 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 2 from: 177545 to: 177589 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 2 from: 46424 to: 46468 | |||
| gi-nr: gi|5353753 gi_def: Mus musculus damage-specific DNA binding protein 1 (DDB1) mRNA, complete cds hsp_num: 1 from: 3961 to: 3987 | |||
| gi-nr: gi|16197725 gi_def: Mus musculus mRNA for damaged-DNA recognition protein 1 (Ddb1 gene) hsp_num: 1 from: 3993 to: 4019 | |||
| gi-nr: gi|16307147 gi_def: Mus musculus damage specific DNA binding protein 1, mRNA (cDNA clone MGC:6603 IMAGE:3487617), complete cds hsp_num: 1 from: 4008 to: 4034 | |||
| gi-nr: gi|74178493 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630016N21 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4027 to: 4053 | |||
| gi-nr: gi|74215028 gi_def: Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730320K18 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4041 to: 4067 | |||
| gi-nr: gi|74138854 gi_def: Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length enriched library, clone:I920020C16 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4059 to: 4085 | |||
| gi-nr: gi|74196165 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630116E15 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4082 to: 4108 | |||
| gi-nr: gi|74182144 gi_def: Mus musculus activated spleen cDNA, RIKEN full-length enriched library, clone:F830219B01 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4081 to: 4107 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_157|beg|1591|length|119|forward|gi | ||
| Query_DNA-Sequence | |||
| acgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaa | |||
| Protein-Sequence | |||
| TPRLRHVSLVELPGVQDTARAKEILGATATLEFREVDDK | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058055 to: 1058147 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287323 to: 287415 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439359 to: 439451 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755317 to: 755409 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617715 to: 617807 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204807 to: 2204899 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130207 to: 130293 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245166 to: 3245258 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337008 to: 337097 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362671 to: 3362763 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882092 to: 2882184 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274675 to: 3274767 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732274 to: 1732366 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666572 to: 1666664 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683228 to: 1683320 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611800 to: 1611892 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285033 to: 2285125 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240474 to: 3240566 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940282 to: 940374 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636080 to: 1636172 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714464 to: 714556 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650095 to: 2650187 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803328 to: 2803417 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901862 to: 1901951 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695011 to: 2695097 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2076 to: 2165 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073303 to: 1073395 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59160 to: 59252 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494481 to: 3494573 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729310 to: 2729402 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504370 to: 1504456 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170200 to: 1170286 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554025 to: 2554111 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461290 to: 461376 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492207 to: 492293 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332587 to: 332673 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846918 to: 2847004 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512167 to: 3512253 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401149 to: 401235 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153837 to: 1153923 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726001 to: 726087 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354757 to: 354843 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977821 to: 977907 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198240 to: 3198326 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437416 to: 3437502 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695376 to: 2695468 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444387 to: 444473 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551285 to: 3551371 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804154 to: 804240 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446455 to: 1446547 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392012 to: 392098 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495905 to: 495991 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983675 to: 2983761 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051539 to: 1051625 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124399 to: 1124485 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442798 to: 442884 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357913 to: 357999 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556696 to: 1556782 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427639 to: 427725 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427639 to: 427725 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12473 to: 12559 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502606 to: 502692 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1858 to: 1944 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357048 to: 357134 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124111 to: 1124197 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275303 to: 1275389 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56965 to: 57051 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204304 to: 204390 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492044 to: 492130 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409862 to: 2409948 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525710 to: 2525796 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507591 to: 507677 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269474 to: 269560 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492046 to: 492132 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7865 to: 7951 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315408 to: 315494 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317386 to: 317472 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413509 to: 413595 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235617 to: 1235703 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463720 to: 1463806 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480030 to: 1480113 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420026 to: 1420112 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628576 to: 628668 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110157 to: 1110243 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145475 to: 1145561 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531439 to: 3531528 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533770 to: 533859 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317771 to: 4317860 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233798 to: 233887 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63898 to: 63987 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177083 to: 177172 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45962 to: 46051 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232523 to: 232612 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240689 to: 1240778 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853341 to: 1853427 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482491 to: 4482580 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261536 to: 4261625 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140880 to: 4140969 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169618 to: 5169707 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928777 to: 4928866 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621699 to: 1621788 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267841 to: 1267918 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241176 to: 2241265 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218635 to: 2218724 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245142 to: 2245231 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597467 to: 4597544 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164667 to: 3164744 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308555 to: 1308632 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987153 to: 987230 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248322 to: 1248399 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278093 to: 4278170 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055750 to: 1055827 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218230 to: 5218307 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724795 to: 5724872 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972487 to: 972564 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877751 to: 3877828 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279388 to: 3279465 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1349 to: 1426 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8227 to: 8304 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1457 to: 1534 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514199 to: 1514276 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388784 to: 1388861 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555408 to: 1555485 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990378 to: 2990452 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44899 to: 44973 | |||
Coding-DNA |
|||
| cgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaa | |||
| Protein-Sequence | |||
| TPRLRHVSLVELPGVQDTARAKEILGATATLEFREVDDK | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058055 to: 1058147 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287323 to: 287415 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439359 to: 439451 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755317 to: 755409 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617715 to: 617807 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204807 to: 2204899 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130207 to: 130293 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245166 to: 3245258 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337008 to: 337097 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362671 to: 3362763 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882092 to: 2882184 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274675 to: 3274767 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732274 to: 1732366 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666572 to: 1666664 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683228 to: 1683320 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611800 to: 1611892 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285033 to: 2285125 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240474 to: 3240566 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940282 to: 940374 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636080 to: 1636172 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714464 to: 714556 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650095 to: 2650187 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803328 to: 2803417 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901862 to: 1901951 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695011 to: 2695097 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2076 to: 2165 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073303 to: 1073395 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59160 to: 59252 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494481 to: 3494573 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729310 to: 2729402 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504370 to: 1504456 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170200 to: 1170286 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554025 to: 2554111 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461290 to: 461376 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492207 to: 492293 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332587 to: 332673 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846918 to: 2847004 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512167 to: 3512253 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401149 to: 401235 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153837 to: 1153923 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726001 to: 726087 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354757 to: 354843 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977821 to: 977907 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198240 to: 3198326 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437416 to: 3437502 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695376 to: 2695468 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444387 to: 444473 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551285 to: 3551371 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804154 to: 804240 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446455 to: 1446547 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392012 to: 392098 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495905 to: 495991 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983675 to: 2983761 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051539 to: 1051625 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124399 to: 1124485 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442798 to: 442884 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357913 to: 357999 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556696 to: 1556782 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427639 to: 427725 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427639 to: 427725 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12473 to: 12559 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502606 to: 502692 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1858 to: 1944 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357048 to: 357134 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124111 to: 1124197 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275303 to: 1275389 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56965 to: 57051 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204304 to: 204390 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492044 to: 492130 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409862 to: 2409948 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525710 to: 2525796 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507591 to: 507677 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269474 to: 269560 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 769 to: 855 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492046 to: 492132 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7865 to: 7951 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315408 to: 315494 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317386 to: 317472 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413509 to: 413595 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235617 to: 1235703 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463720 to: 1463806 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480030 to: 1480113 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420026 to: 1420112 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628576 to: 628668 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110157 to: 1110243 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145475 to: 1145561 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531439 to: 3531528 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533770 to: 533859 | |||
| gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317771 to: 4317860 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233798 to: 233887 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63898 to: 63987 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177083 to: 177172 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45962 to: 46051 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232523 to: 232612 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240689 to: 1240778 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853341 to: 1853427 | |||
| gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482491 to: 4482580 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261536 to: 4261625 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140880 to: 4140969 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169618 to: 5169707 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928777 to: 4928866 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621699 to: 1621788 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267841 to: 1267918 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241176 to: 2241265 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218635 to: 2218724 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245142 to: 2245231 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597467 to: 4597544 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164667 to: 3164744 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308555 to: 1308632 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987153 to: 987230 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248322 to: 1248399 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278093 to: 4278170 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055750 to: 1055827 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218230 to: 5218307 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724795 to: 5724872 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972487 to: 972564 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877751 to: 3877828 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279388 to: 3279465 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1349 to: 1426 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8227 to: 8304 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1457 to: 1534 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514199 to: 1514276 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388784 to: 1388861 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555408 to: 1555485 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990378 to: 2990452 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44899 to: 44973 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_160|beg|2285|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| atcgcactaatTggcgaaccTtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcgatgccaacg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcgcactaatTggcgaaccTtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcga | |||
| Protein-Sequence | |||
| IDRHYRPSTRYQQYPARSMVAPGIIDITPMINTKGSPISA | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130896 to: 130955 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618404 to: 618463 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204151 to: 2204210 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058744 to: 1058803 | |||
Coding-DNA |
|||
| TtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcga | |||
| Protein-Sequence | |||
| HRPPLPTVNTIPAIPGKVNGCARDHRHYANDQHER | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 1465 to: 1512 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 288013 to: 288060 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797303 to: 797350 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 190 to: 231 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130944 to: 130985 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618452 to: 618493 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204121 to: 2204162 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 3 from: 1146212 to: 1146253 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058792 to: 1058833 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 4 from: 756054 to: 756095 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438673 to: 438714 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 337745 to: 337789 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 4 from: 2284350 to: 2284394 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 3 from: 2694690 to: 2694734 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361988 to: 3362032 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273992 to: 3274036 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881409 to: 2881453 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3305663 to: 3305707 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 3 from: 1480761 to: 1480805 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667303 to: 1667347 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 5 from: 1191749 to: 1191793 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612531 to: 1612575 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 3239791 to: 3239832 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1683959 to: 1684003 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733005 to: 1733049 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1204807 to: 1204851 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 2728627 to: 2728671 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 3 from: 3244483 to: 3244527 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 3 from: 1636811 to: 1636855 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 2649412 to: 2649456 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 3 from: 1503 to: 1541 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 1124845 to: 1124883 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 3511481 to: 3511519 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 2982989 to: 2983027 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3550599 to: 3550637 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 3436733 to: 3436768 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 1125133 to: 1125171 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 804888 to: 804926 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 1052273 to: 1052311 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 3197554 to: 3197592 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445763 to: 1445807 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217153 to: 1217194 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 124156 to: 124179 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 3 from: 1674853 to: 1674885 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084361 to: 1084402 | |||
| gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1334566 to: 1334610 | |||
| gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 797610 to: 797654 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240487 to: 2240528 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217946 to: 2217987 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44770 to: 44814 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_163|beg|2831|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| gggggctggatttcacggcggtactttgattgaagtTgggctttgaacagcctgccaatctggagTcaaatccgtagcgcccttgaagcgaaaggttttggtgatgctacc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_164|beg|1149|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| acctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtg | |||
| Protein-Sequence | |||
| LAPSTPYWLESIGAAPMKLLALDLRGGVHFLMEV | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 313 to: 369 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 12 from: 367 to: 411 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796151 to: 796207 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 286861 to: 286917 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754852 to: 754908 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754906 to: 754950 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439860 to: 439916 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439818 to: 439862 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803823 to: 2803879 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803781 to: 2803825 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057590 to: 1057646 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057644 to: 1057688 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617250 to: 617306 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617304 to: 617348 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479628 to: 1479672 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650551 to: 2650595 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 5 from: 3001931 to: 3001975 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1666164 to: 1666208 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1682820 to: 1682864 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901400 to: 1901456 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901454 to: 1901498 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1731812 to: 1731868 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1731866 to: 1731910 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1203719 to: 1203763 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1611392 to: 1611436 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882590 to: 2882646 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2882548 to: 2882592 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3306751 to: 3306795 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729808 to: 2729864 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729810 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 2 from: 4597911 to: 4597955 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494937 to: 3494981 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 6 from: 4144619 to: 4144663 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3363127 to: 3363171 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3275131 to: 3275175 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3811454 to: 3811498 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240930 to: 3240974 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205308 to: 2205364 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2205266 to: 2205310 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 961190 to: 961234 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245664 to: 3245720 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245622 to: 3245666 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1144410 to: 1144454 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285525 to: 2285581 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2285483 to: 2285527 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635672 to: 1635716 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695880 to: 2695936 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2695838 to: 2695882 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1109755 to: 1109799 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 367 to: 411 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1267430 to: 1267474 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376717 to: 3376761 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 578392 to: 578436 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 57409 to: 57453 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129745 to: 129801 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 129799 to: 129843 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123709 to: 1123753 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512611 to: 3512655 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 3437860 to: 3437904 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984119 to: 2984163 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551729 to: 3551773 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123997 to: 1124041 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803752 to: 803796 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051137 to: 1051181 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977365 to: 977421 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 977419 to: 977463 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198684 to: 3198728 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169798 to: 1169842 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274901 to: 1274945 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279871 to: 3279927 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279829 to: 3279873 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847362 to: 2847406 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 40151 to: 40195 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1456 to: 1500 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491644 to: 491688 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491642 to: 491686 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502204 to: 502248 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443985 to: 444029 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442396 to: 442440 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460888 to: 460932 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495503 to: 495547 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413107 to: 413151 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554469 to: 2554513 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427237 to: 427281 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491805 to: 491849 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427237 to: 427281 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357511 to: 357555 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356646 to: 356690 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391610 to: 391654 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316984 to: 317028 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315852 to: 315896 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7463 to: 7507 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526154 to: 2526198 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507189 to: 507233 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410306 to: 2410350 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1218283 to: 1218327 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1085491 to: 1085535 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203902 to: 203946 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12071 to: 12115 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400747 to: 400791 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622197 to: 1622250 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622152 to: 1622190 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245640 to: 2245693 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245595 to: 2245633 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241674 to: 2241727 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241629 to: 2241667 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219133 to: 2219186 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219088 to: 2219126 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695508 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990816 to: 2990860 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394869 to: 394913 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 714062 to: 714106 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301236 to: 301280 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1154281 to: 1154319 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556240 to: 1556293 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1556300 to: 1556338 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766326 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2523 to: 2561 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1823608 to: 1823652 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 2 from: 552346 to: 552390 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 2 from: 1463324 to: 1463362 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628171 to: 628215 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 2 from: 6388 to: 6432 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853794 to: 1853838 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1504814 to: 1504852 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940773 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308147 to: 1308191 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1247914 to: 1247958 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1126481 to: 1126525 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1235221 to: 1235259 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 2 from: 333031 to: 333069 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 2 from: 726445 to: 726483 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 2 from: 269918 to: 269956 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 2 from: 354361 to: 354399 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11920 to: 11964 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145073 to: 1145117 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59654 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 2 from: 45328 to: 45372 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240281 to: 1240325 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514169 to: 1514213 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534267 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446908 to: 1446952 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073794 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868913 to: 1868957 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 2 from: 2172252 to: 2172296 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417892 to: 1417936 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 400 to: 444 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419615 to: 1419659 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 2 from: 300869 to: 300913 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2920991 to: 2921035 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 831986 to: 832030 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526506 to: 526550 | |||
Coding-DNA |
|||
| cctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtg | |||
| Protein-Sequence | |||
| LAPSTPYWLESIGAAPMKLLALDLRGGVHFLMEV | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 313 to: 369 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 12 from: 367 to: 411 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796151 to: 796207 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 286861 to: 286917 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754852 to: 754908 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754906 to: 754950 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439860 to: 439916 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439818 to: 439862 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803823 to: 2803879 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803781 to: 2803825 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057590 to: 1057646 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057644 to: 1057688 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617250 to: 617306 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617304 to: 617348 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479628 to: 1479672 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650551 to: 2650595 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 5 from: 3001931 to: 3001975 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1666164 to: 1666208 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1682820 to: 1682864 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901400 to: 1901456 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901454 to: 1901498 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1731812 to: 1731868 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1731866 to: 1731910 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1203719 to: 1203763 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1611392 to: 1611436 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882590 to: 2882646 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2882548 to: 2882592 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3306751 to: 3306795 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729808 to: 2729864 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729810 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 2 from: 4597911 to: 4597955 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494937 to: 3494981 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 6 from: 4144619 to: 4144663 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3363127 to: 3363171 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3275131 to: 3275175 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3811454 to: 3811498 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240930 to: 3240974 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205308 to: 2205364 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2205266 to: 2205310 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 961190 to: 961234 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245664 to: 3245720 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245622 to: 3245666 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1144410 to: 1144454 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285525 to: 2285581 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2285483 to: 2285527 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635672 to: 1635716 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695880 to: 2695936 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2695838 to: 2695882 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1109755 to: 1109799 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 367 to: 411 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1267430 to: 1267474 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376717 to: 3376761 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 578392 to: 578436 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 57409 to: 57453 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129745 to: 129801 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 129799 to: 129843 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123709 to: 1123753 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512611 to: 3512655 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 3437860 to: 3437904 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984119 to: 2984163 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551729 to: 3551773 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123997 to: 1124041 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803752 to: 803796 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051137 to: 1051181 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977365 to: 977421 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 977419 to: 977463 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198684 to: 3198728 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169798 to: 1169842 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274901 to: 1274945 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279871 to: 3279927 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279829 to: 3279873 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847362 to: 2847406 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 40151 to: 40195 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1456 to: 1500 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491644 to: 491688 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491642 to: 491686 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502204 to: 502248 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443985 to: 444029 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442396 to: 442440 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460888 to: 460932 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495503 to: 495547 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413107 to: 413151 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554469 to: 2554513 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427237 to: 427281 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491805 to: 491849 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427237 to: 427281 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357511 to: 357555 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356646 to: 356690 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391610 to: 391654 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316984 to: 317028 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315852 to: 315896 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 367 to: 411 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7463 to: 7507 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526154 to: 2526198 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507189 to: 507233 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410306 to: 2410350 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1218283 to: 1218327 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1085491 to: 1085535 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203902 to: 203946 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12071 to: 12115 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400747 to: 400791 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622197 to: 1622250 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622152 to: 1622190 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245640 to: 2245693 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245595 to: 2245633 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241674 to: 2241727 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241629 to: 2241667 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219133 to: 2219186 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219088 to: 2219126 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695508 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990816 to: 2990860 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394869 to: 394913 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 714062 to: 714106 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301236 to: 301280 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1154281 to: 1154319 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556240 to: 1556293 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1556300 to: 1556338 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766326 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2523 to: 2561 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1823608 to: 1823652 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 2 from: 552346 to: 552390 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 2 from: 1463324 to: 1463362 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628171 to: 628215 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 2 from: 6388 to: 6432 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853794 to: 1853838 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1504814 to: 1504852 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940773 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308147 to: 1308191 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1247914 to: 1247958 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1126481 to: 1126525 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1235221 to: 1235259 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 2 from: 333031 to: 333069 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 2 from: 726445 to: 726483 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 2 from: 269918 to: 269956 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 2 from: 354361 to: 354399 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11920 to: 11964 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145073 to: 1145117 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59654 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 2 from: 45328 to: 45372 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240281 to: 1240325 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514169 to: 1514213 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534267 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446908 to: 1446952 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073794 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868913 to: 1868957 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 2 from: 2172252 to: 2172296 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417892 to: 1417936 | |||
| gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 400 to: 444 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419615 to: 1419659 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 2 from: 300869 to: 300913 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2920991 to: 2921035 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 831986 to: 832030 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526506 to: 526550 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_166|beg|323|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| cgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctgtgcatcccaatagaatcaacat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctg | |||
| Protein-Sequence | |||
| SSTRVVTAKCHHYKKTSLISCIWVGFCVVSRLNSPL | |||
| Hit-Information Section | |||
| gi-nr: gi|85099348 gi_def: Neurospora crassa OR74A hypothetical protein (NCU01255.1) partial mRNA hsp_num: 2 from: 1353 to: 1379 | |||
Coding-DNA |
|||
| gagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctg | |||
| Protein-Sequence | |||
| SSTRVVTAKCHHYKKTSLISCIWVGFCVVSRLNSPL | |||
| Hit-Information Section | |||
| gi-nr: gi|85099348 gi_def: Neurospora crassa OR74A hypothetical protein (NCU01255.1) partial mRNA hsp_num: 2 from: 1353 to: 1379 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_168|beg|1332|length|128|forward|gi | ||
| Query_DNA-Sequence | |||
| accgcgcgatccgtccattatcTggatgcggttgaagtgaccctgcgtTgatgccgagcagcttgcgcaaactaagctgcttctggTagtcgaaacaccgtgatatgacctttacgacttcagaatcc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_169|beg|684|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| tTagtgggtcgtatcactaagattgctgaagataacgcttacatcaTcaatcgagttgaacaccaaTcaacgaaTgttgtgatcaagaaggacttcgTtgactgcagtgctTaccaaaaggtacgctgaaatctcttaaaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_171|beg|2404|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| cacgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaatt | |||
| Protein-Sequence | |||
| HVTDFSSVFVKSYAEGKNPQQAIHQGYANAFSTIADANITTLI | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438534 to: 438620 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756148 to: 756234 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 284 to: 370 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203982 to: 2204068 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131038 to: 131124 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058886 to: 1058972 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618546 to: 618632 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694551 to: 2694640 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881270 to: 2881353 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733105 to: 1733188 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244344 to: 3244427 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636911 to: 1636994 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284211 to: 2284291 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629481 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852507 to: 1852578 | |||
Coding-DNA |
|||
| acgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaatt | |||
| Protein-Sequence | |||
| HVTDFSSVFVKSYAEGKNPQQAIHQGYANAFSTIADANITTLI | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438534 to: 438620 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756148 to: 756234 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 284 to: 370 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203982 to: 2204068 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131038 to: 131124 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058886 to: 1058972 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618546 to: 618632 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694551 to: 2694640 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881270 to: 2881353 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733105 to: 1733188 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244344 to: 3244427 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636911 to: 1636994 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284211 to: 2284291 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629481 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852507 to: 1852578 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_175|beg|9|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| ggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtgatcaagTatccgtaatgcagcacata | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtg | |||
| Protein-Sequence | |||
| GVRRGIDMFDCVMPTRNALTVTYLLTGGV | |||
| Hit-Information Section | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864209 to: 1864295 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108337 to: 2108417 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889607 to: 889660 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65654 to: 65707 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178841 to: 178894 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48763 to: 48816 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688226 to: 688279 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 144 to: 194 | |||
| gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906034 to: 906084 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750376 to: 750429 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299998 to: 300051 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693134 to: 693187 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803386 to: 803439 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684714 to: 684767 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254210 to: 254263 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749917 to: 749970 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295824 to: 295877 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393622 to: 393675 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899083 to: 899136 | |||
| gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 1017657 to: 1017710 | |||
| gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2645137 to: 2645190 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919685 to: 2919738 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200950 to: 3201003 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706163 to: 706216 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830750 to: 830803 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1419130 to: 1419183 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867724 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542945 to: 2542998 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283006 to: 3283059 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267136 to: 3267189 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191251 to: 1191304 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302241 to: 302294 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322222 to: 322275 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369764 to: 3369817 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481759 to: 481812 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527907 to: 527960 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491558 to: 2491611 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693066 to: 3693119 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079059 to: 3079112 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434264 to: 3434317 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5186538 to: 5186585 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427551 to: 1427604 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949315 to: 3949368 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 3 from: 1926424 to: 1926474 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733339 to: 733389 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59594 to: 59644 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712883 to: 712933 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3259575 to: 3259622 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4579269 to: 4579316 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992238 to: 1992291 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3117648 to: 3117695 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1973834 to: 1973881 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2917806 to: 2917853 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 2819833 to: 2819880 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 939551 to: 939601 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 2889395 to: 2889445 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1967627 to: 1967674 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3267403 to: 3267450 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4181553 to: 4181600 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535412 to: 535462 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529887 to: 3529937 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 207694 to: 207741 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 344896 to: 344952 | |||
| gi-nr: gi|116096021 gi_def: Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome hsp_num: 1 from: 328812 to: 328859 | |||
| gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638392 to: 1638445 | |||
| gi-nr: gi|91202367 gi_def: Kuenenia stuttgartiensis genome fragment KUST_D (4 of 5) hsp_num: 1 from: 642270 to: 642317 | |||
| gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354232 to: 1354285 | |||
| gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14074 to: 14115 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4738382 to: 4738429 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2537240 to: 2537287 | |||
| gi-nr: gi|17740104 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 150 of 256 of the complete sequence hsp_num: 1 from: 7391 to: 7438 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2217753 to: 2217800 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1664650 to: 1664697 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 2289179 to: 2289223 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1067930 to: 1067974 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 749504 to: 749548 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1502945 to: 1502989 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 944096 to: 944140 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 2 from: 1065934 to: 1065978 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1116940 to: 1116984 | |||
| gi-nr: gi|39649375 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 9/16 hsp_num: 1 from: 172634 to: 172681 | |||
| gi-nr: gi|17982828 gi_def: Brucella melitensis 16M chromosome I, section 86 of 195 of the complete sequence hsp_num: 1 from: 11530 to: 11574 | |||
| gi-nr: gi|17982952 gi_def: Brucella melitensis 16M chromosome I, section 97 of 195 of the complete sequence hsp_num: 1 from: 9329 to: 9373 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 570238 to: 570282 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 963099 to: 963143 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 2 from: 1083279 to: 1083323 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 960219 to: 960263 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 2 from: 1080430 to: 1080474 | |||
| gi-nr: gi|15667437 gi_def: Enterococcus faecium gene for tRNA-guanine transglycosylase, partial cds hsp_num: 1 from: 510 to: 557 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 128689 to: 128736 | |||
| gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8487 to: 8534 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 365726 to: 365773 | |||
| gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1842 to: 1889 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665903 to: 665941 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1142425 to: 1142472 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2387356 to: 2387403 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575212 to: 1575262 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2298462 to: 2298509 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 903955 to: 904002 | |||
| gi-nr: gi|15620220 gi_def: Rickettsia conorii str. Malish 7, section 93 of 114 of the complete genome hsp_num: 1 from: 441 to: 488 | |||
| gi-nr: gi|3861237 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 4/4 hsp_num: 1 from: 35125 to: 35172 | |||
| gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199468 to: 1199518 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1349855 to: 1349902 | |||
| gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 987110 to: 987154 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1586368 to: 1586412 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 270622 to: 270669 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 1310972 to: 1311016 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1362452 to: 1362499 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 1375031 to: 1375075 | |||
| gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 2001719 to: 2001763 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2138207 to: 2138251 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 1604812 to: 1604856 | |||
| gi-nr: gi|157128020 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL010993) mRNA, complete cds hsp_num: 1 from: 820 to: 870 | |||
| gi-nr: gi|157109378 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL015117) mRNA, complete cds hsp_num: 1 from: 820 to: 870 | |||
| gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1287 | |||
| gi-nr: gi|58613532 gi_def: Heterocapsa triquetra clone HTQTR1 chloroplast queuine tRNA ribosyl transferase mRNA, partial cds; nuclear gene for chloroplast product hsp_num: 1 from: 398 to: 445 | |||
Coding-DNA |
|||
| gtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtg | |||
| Protein-Sequence | |||
| GVRRGIDMFDCVMPTRNALTVTYLLTGGV | |||
| Hit-Information Section | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864209 to: 1864295 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108337 to: 2108417 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889607 to: 889660 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65654 to: 65707 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178841 to: 178894 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48763 to: 48816 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688226 to: 688279 | |||
| gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 144 to: 194 | |||
| gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906034 to: 906084 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750376 to: 750429 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299998 to: 300051 | |||
| gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693134 to: 693187 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803386 to: 803439 | |||
| gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684714 to: 684767 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254210 to: 254263 | |||
| gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749917 to: 749970 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295824 to: 295877 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393622 to: 393675 | |||
| gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899083 to: 899136 | |||
| gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 1017657 to: 1017710 | |||
| gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2645137 to: 2645190 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919685 to: 2919738 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200950 to: 3201003 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706163 to: 706216 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830750 to: 830803 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1419130 to: 1419183 | |||
| gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867724 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542945 to: 2542998 | |||
| gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283006 to: 3283059 | |||
| gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267136 to: 3267189 | |||
| gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191251 to: 1191304 | |||
| gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302241 to: 302294 | |||
| gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322222 to: 322275 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369764 to: 3369817 | |||
| gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481759 to: 481812 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527907 to: 527960 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491558 to: 2491611 | |||
| gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693066 to: 3693119 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079059 to: 3079112 | |||
| gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434264 to: 3434317 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5186538 to: 5186585 | |||
| gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427551 to: 1427604 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949315 to: 3949368 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 3 from: 1926424 to: 1926474 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733339 to: 733389 | |||
| gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59594 to: 59644 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712883 to: 712933 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3259575 to: 3259622 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4579269 to: 4579316 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992238 to: 1992291 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3117648 to: 3117695 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1973834 to: 1973881 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2917806 to: 2917853 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 2819833 to: 2819880 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 939551 to: 939601 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 2889395 to: 2889445 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1967627 to: 1967674 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3267403 to: 3267450 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4181553 to: 4181600 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535412 to: 535462 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529887 to: 3529937 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 207694 to: 207741 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 344896 to: 344952 | |||
| gi-nr: gi|116096021 gi_def: Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome hsp_num: 1 from: 328812 to: 328859 | |||
| gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638392 to: 1638445 | |||
| gi-nr: gi|91202367 gi_def: Kuenenia stuttgartiensis genome fragment KUST_D (4 of 5) hsp_num: 1 from: 642270 to: 642317 | |||
| gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354232 to: 1354285 | |||
| gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14074 to: 14115 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4738382 to: 4738429 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2537240 to: 2537287 | |||
| gi-nr: gi|17740104 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 150 of 256 of the complete sequence hsp_num: 1 from: 7391 to: 7438 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2217753 to: 2217800 | |||
| gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1664650 to: 1664697 | |||
| gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 2289179 to: 2289223 | |||
| gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1067930 to: 1067974 | |||
| gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 749504 to: 749548 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1502945 to: 1502989 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 944096 to: 944140 | |||
| gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 2 from: 1065934 to: 1065978 | |||
| gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1116940 to: 1116984 | |||
| gi-nr: gi|39649375 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 9/16 hsp_num: 1 from: 172634 to: 172681 | |||
| gi-nr: gi|17982828 gi_def: Brucella melitensis 16M chromosome I, section 86 of 195 of the complete sequence hsp_num: 1 from: 11530 to: 11574 | |||
| gi-nr: gi|17982952 gi_def: Brucella melitensis 16M chromosome I, section 97 of 195 of the complete sequence hsp_num: 1 from: 9329 to: 9373 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 570238 to: 570282 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 963099 to: 963143 | |||
| gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 2 from: 1083279 to: 1083323 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 960219 to: 960263 | |||
| gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 2 from: 1080430 to: 1080474 | |||
| gi-nr: gi|15667437 gi_def: Enterococcus faecium gene for tRNA-guanine transglycosylase, partial cds hsp_num: 1 from: 510 to: 557 | |||
| gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 128689 to: 128736 | |||
| gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8487 to: 8534 | |||
| gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 365726 to: 365773 | |||
| gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1842 to: 1889 | |||
| gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665903 to: 665941 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1142425 to: 1142472 | |||
| gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2387356 to: 2387403 | |||
| gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575212 to: 1575262 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2298462 to: 2298509 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 903955 to: 904002 | |||
| gi-nr: gi|15620220 gi_def: Rickettsia conorii str. Malish 7, section 93 of 114 of the complete genome hsp_num: 1 from: 441 to: 488 | |||
| gi-nr: gi|3861237 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 4/4 hsp_num: 1 from: 35125 to: 35172 | |||
| gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199468 to: 1199518 | |||
| gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1349855 to: 1349902 | |||
| gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 987110 to: 987154 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1586368 to: 1586412 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 270622 to: 270669 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 1310972 to: 1311016 | |||
| gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1362452 to: 1362499 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 1375031 to: 1375075 | |||
| gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 2001719 to: 2001763 | |||
| gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2138207 to: 2138251 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 1604812 to: 1604856 | |||
| gi-nr: gi|157128020 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL010993) mRNA, complete cds hsp_num: 1 from: 820 to: 870 | |||
| gi-nr: gi|157109378 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL015117) mRNA, complete cds hsp_num: 1 from: 820 to: 870 | |||
| gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1287 | |||
| gi-nr: gi|58613532 gi_def: Heterocapsa triquetra clone HTQTR1 chloroplast queuine tRNA ribosyl transferase mRNA, partial cds; nuclear gene for chloroplast product hsp_num: 1 from: 398 to: 445 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_178|beg|356|length|104|forward|gi | ||
| Query_DNA-Sequence | |||
| accactacaaaagacaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattacccctgtgcatcccaatagaatcaacattaaacaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_182|beg|665|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgttgacctctggtggtctagtgggtcgtatcactaagattgcTtgaagataacgcttacatcacaatcgagttgaacaccaacaacgaagttgtgatcaaaTgaaTggacttcgtgacctgcagtgctac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_183|beg|1624|length|146|forward|gi | ||
| Query_DNA-Sequence | |||
| gccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaatcaagt | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaat | |||
| Protein-Sequence | |||
| PGVQDTARAKKILRARTRQPLNFREVDDKADPCRCGSQDVRLLAVEI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058067 to: 1058111 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058121 to: 1058153 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204887 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204801 to: 2204833 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940362 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073345 to: 1073383 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2540978 to: 2541016 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2489591 to: 2489629 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275315 to: 1275359 | |||
Coding-DNA |
|||
| ccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaat | |||
| Protein-Sequence | |||
| PGVQDTARAKKILRARTRQPLNFREVDDKADPCRCGSQDVRLLAVEI | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058067 to: 1058111 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058121 to: 1058153 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204887 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204801 to: 2204833 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940362 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073345 to: 1073383 | |||
| gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2540978 to: 2541016 | |||
| gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2489591 to: 2489629 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275315 to: 1275359 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_184|beg|744|length|125|forward|gi | ||
| Query_DNA-Sequence | |||
| ccaacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctttaaaacagccataaggatcctcgctgtgctaaaccgttatccgttatggaagta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| caacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctt | |||
| Protein-Sequence | |||
| NNEVVIKKDFVTAVLPKGTLKSL | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754447 to: 754524 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440244 to: 440321 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616845 to: 616922 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057185 to: 1057262 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 286456 to: 286539 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129336 to: 129407 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205730 to: 2205801 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 579 to: 644 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274439 to: 1274507 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1632 to: 1697 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1633 to: 1698 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 997 to: 1062 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491185 to: 491250 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491183 to: 491248 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400289 to: 400360 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501745 to: 501810 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443526 to: 443591 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441937 to: 442002 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460429 to: 460494 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495044 to: 495109 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412648 to: 412713 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426778 to: 426843 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491346 to: 491411 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426778 to: 426843 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357052 to: 357117 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356187 to: 356252 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391151 to: 391216 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316525 to: 316590 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976961 to: 977032 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316290 to: 316355 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109293 to: 1109361 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7004 to: 7069 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554904 to: 2554972 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526592 to: 2526657 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506730 to: 506795 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438292 to: 3438363 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410744 to: 2410809 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847800 to: 2847865 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627703 to: 627771 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203443 to: 203508 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11612 to: 11677 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57847 to: 57912 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123250 to: 1123321 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513043 to: 3513114 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984551 to: 2984622 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552161 to: 3552232 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123538 to: 1123609 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803293 to: 803364 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050678 to: 1050749 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199116 to: 3199187 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245577 to: 245648 | |||
| gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 1 from: 337 to: 402 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 140071 to: 140136 | |||
Coding-DNA |
|||
| caacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctt | |||
| Protein-Sequence | |||
| NNEVVIKKDFVTAVLPKGTLKSL | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754447 to: 754524 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440244 to: 440321 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616845 to: 616922 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057185 to: 1057262 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 286456 to: 286539 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129336 to: 129407 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205730 to: 2205801 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 579 to: 644 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274439 to: 1274507 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1632 to: 1697 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1633 to: 1698 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 997 to: 1062 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491185 to: 491250 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491183 to: 491248 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400289 to: 400360 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501745 to: 501810 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443526 to: 443591 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441937 to: 442002 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460429 to: 460494 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495044 to: 495109 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412648 to: 412713 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426778 to: 426843 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491346 to: 491411 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426778 to: 426843 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357052 to: 357117 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356187 to: 356252 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391151 to: 391216 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316525 to: 316590 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976961 to: 977032 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316290 to: 316355 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109293 to: 1109361 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7004 to: 7069 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554904 to: 2554972 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526592 to: 2526657 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506730 to: 506795 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438292 to: 3438363 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410744 to: 2410809 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847800 to: 2847865 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627703 to: 627771 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203443 to: 203508 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11612 to: 11677 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57847 to: 57912 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123250 to: 1123321 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513043 to: 3513114 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984551 to: 2984622 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552161 to: 3552232 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123538 to: 1123609 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803293 to: 803364 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050678 to: 1050749 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199116 to: 3199187 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245577 to: 245648 | |||
| gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 1 from: 337 to: 402 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 140071 to: 140136 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_185|beg|2480|length|103|forward|gi | ||
| Query_DNA-Sequence | |||
| tacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttcgcag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttc | |||
| Protein-Sequence | |||
| AKPLIAPVPTANKMIAVIKVVMLASAMVLNALA | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756186 to: 756284 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438484 to: 438582 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618584 to: 618682 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131076 to: 131174 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203932 to: 2204030 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612669 to: 1612764 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058924 to: 1059022 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684097 to: 1684192 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667441 to: 1667536 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 322 to: 420 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244294 to: 3244389 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881220 to: 2881315 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733143 to: 1733238 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694501 to: 2694596 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636946 to: 1637044 | |||
Coding-DNA |
|||
| acgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttc | |||
| Protein-Sequence | |||
| AKPLIAPVPTANKMIAVIKVVMLASAMVLNALA | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756186 to: 756284 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438484 to: 438582 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618584 to: 618682 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131076 to: 131174 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203932 to: 2204030 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612669 to: 1612764 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058924 to: 1059022 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684097 to: 1684192 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667441 to: 1667536 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 322 to: 420 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244294 to: 3244389 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881220 to: 2881315 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733143 to: 1733238 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694501 to: 2694596 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636946 to: 1637044 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_186|beg|524|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| gTccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaaaacctg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| TccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaa | |||
| Protein-Sequence | |||
| PHKVAVFEMIIMLAMFAVIFYFMIYRPQCLSVSKNTK | |||
| Hit-Information Section | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900797 to: 1900859 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205940 to: 2206002 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804420 to: 2804482 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234547 to: 1234609 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129135 to: 129197 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462652 to: 1462714 | |||
Coding-DNA |
|||
| TccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaa | |||
| Protein-Sequence | |||
| PHKVAVFEMIIMLAMFAVIFYFMIYRPQCLSVSKNTK | |||
| Hit-Information Section | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900797 to: 1900859 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205940 to: 2206002 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804420 to: 2804482 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234547 to: 1234609 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129135 to: 129197 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462652 to: 1462714 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_189|beg|1932|length|136|forward|gi | ||
| Query_DNA-Sequence | |||
| agctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaagtTcattctgaccaagcatgaagaagtgattaaccaagcgacgattcagtcggcattgggacgtaacttccgta | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaa | |||
| Protein-Sequence | |||
| TLPSGERLPLSLYSANTVAIS | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287643 to: 287705 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 4 from: 1058375 to: 1058437 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 130527 to: 130589 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 2204517 to: 2204579 | |||
Coding-DNA |
|||
| gctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaa | |||
| Protein-Sequence | |||
| TLPSGERLPLSLYSANTVAIS | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287643 to: 287705 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 4 from: 1058375 to: 1058437 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 130527 to: 130589 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 2204517 to: 2204579 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_190|beg|1517|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccggg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccg | |||
| Protein-Sequence | |||
| SPVEQNITILRNRVNELGVAEPLVQRQGATRIVVELP | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057965 to: 1058069 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439437 to: 439541 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755227 to: 755331 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617729 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130221 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204885 to: 2204989 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110067 to: 1110171 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57037 to: 57141 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170110 to: 1170214 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512239 to: 3512343 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198312 to: 3198416 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803403 to: 2803507 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437488 to: 3437592 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901772 to: 1901876 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551357 to: 3551461 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804064 to: 804168 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983747 to: 2983851 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051449 to: 1051553 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124309 to: 1124413 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124021 to: 1124125 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987063 to: 987167 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972397 to: 972501 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846990 to: 2847094 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401059 to: 401163 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275213 to: 1275317 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267751 to: 1267855 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285111 to: 2285215 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554097 to: 2554201 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461200 to: 461304 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492117 to: 492221 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279451 to: 3279555 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977731 to: 977835 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444297 to: 444401 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391922 to: 392026 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495815 to: 495919 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055660 to: 1055764 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442708 to: 442812 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1412 to: 1516 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8290 to: 8394 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1520 to: 1624 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357823 to: 357927 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514109 to: 1514213 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427549 to: 427653 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427549 to: 427653 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12383 to: 12487 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502516 to: 502620 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1768 to: 1872 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356958 to: 357062 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204214 to: 204318 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491954 to: 492058 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409934 to: 2410038 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525782 to: 2525886 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507501 to: 507605 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491956 to: 492060 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7775 to: 7879 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315480 to: 315584 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317296 to: 317400 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413419 to: 413523 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388694 to: 1388798 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555318 to: 1555422 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990438 to: 2990542 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877814 to: 3877918 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729388 to: 2729492 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695454 to: 2695558 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218293 to: 5218397 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494559 to: 3494663 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362749 to: 3362853 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308465 to: 1308569 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882170 to: 2882274 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274753 to: 3274857 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732184 to: 1732288 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666482 to: 1666586 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248232 to: 1248336 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245244 to: 3245348 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683138 to: 1683242 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611710 to: 1611814 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278156 to: 4278260 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233708 to: 233812 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232433 to: 232537 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145489 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853413 to: 1853517 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650173 to: 2650271 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164577 to: 3164681 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240552 to: 3240656 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419936 to: 1420040 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172570 to: 2172674 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504442 to: 1504546 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635990 to: 1636094 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597530 to: 4597634 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940360 to: 940470 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301554 to: 301658 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40466 to: 40570 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371570 to: 3371674 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080816 to: 3080920 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628486 to: 628590 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2151 to: 2261 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59238 to: 59348 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44962 to: 45066 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463630 to: 1463734 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153909 to: 1154019 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377035 to: 3377139 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695083 to: 2695187 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332659 to: 332763 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354667 to: 354771 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714374 to: 714478 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621777 to: 1621881 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241254 to: 2241358 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218713 to: 2218817 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245220 to: 2245324 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12226 to: 12330 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6694 to: 6798 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217917 to: 1218021 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085125 to: 1085229 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073488 | |||
Coding-DNA |
|||
| tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccg | |||
| Protein-Sequence | |||
| SPVEQNITILRNRVNELGVAEPLVQRQGATRIVVELP | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057965 to: 1058069 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439437 to: 439541 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755227 to: 755331 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617729 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130221 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204885 to: 2204989 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110067 to: 1110171 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57037 to: 57141 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170110 to: 1170214 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512239 to: 3512343 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198312 to: 3198416 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803403 to: 2803507 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437488 to: 3437592 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901772 to: 1901876 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551357 to: 3551461 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804064 to: 804168 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983747 to: 2983851 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051449 to: 1051553 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124309 to: 1124413 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124021 to: 1124125 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987063 to: 987167 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972397 to: 972501 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846990 to: 2847094 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401059 to: 401163 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275213 to: 1275317 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267751 to: 1267855 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285111 to: 2285215 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554097 to: 2554201 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461200 to: 461304 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492117 to: 492221 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279451 to: 3279555 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977731 to: 977835 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444297 to: 444401 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391922 to: 392026 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495815 to: 495919 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055660 to: 1055764 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442708 to: 442812 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1412 to: 1516 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8290 to: 8394 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1520 to: 1624 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357823 to: 357927 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514109 to: 1514213 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427549 to: 427653 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427549 to: 427653 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12383 to: 12487 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502516 to: 502620 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1768 to: 1872 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356958 to: 357062 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204214 to: 204318 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491954 to: 492058 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409934 to: 2410038 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525782 to: 2525886 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507501 to: 507605 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 679 to: 783 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491956 to: 492060 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7775 to: 7879 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315480 to: 315584 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317296 to: 317400 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413419 to: 413523 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388694 to: 1388798 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555318 to: 1555422 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990438 to: 2990542 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877814 to: 3877918 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729388 to: 2729492 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695454 to: 2695558 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218293 to: 5218397 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494559 to: 3494663 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362749 to: 3362853 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308465 to: 1308569 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882170 to: 2882274 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274753 to: 3274857 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732184 to: 1732288 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666482 to: 1666586 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248232 to: 1248336 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245244 to: 3245348 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683138 to: 1683242 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611710 to: 1611814 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278156 to: 4278260 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233708 to: 233812 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232433 to: 232537 | |||
| gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145489 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853413 to: 1853517 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650173 to: 2650271 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164577 to: 3164681 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240552 to: 3240656 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419936 to: 1420040 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172570 to: 2172674 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504442 to: 1504546 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635990 to: 1636094 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597530 to: 4597634 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940360 to: 940470 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301554 to: 301658 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40466 to: 40570 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371570 to: 3371674 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080816 to: 3080920 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628486 to: 628590 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2151 to: 2261 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59238 to: 59348 | |||
| gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44962 to: 45066 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463630 to: 1463734 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153909 to: 1154019 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377035 to: 3377139 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695083 to: 2695187 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332659 to: 332763 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354667 to: 354771 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714374 to: 714478 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621777 to: 1621881 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241254 to: 2241358 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218713 to: 2218817 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245220 to: 2245324 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12226 to: 12330 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6694 to: 6798 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217917 to: 1218021 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085125 to: 1085229 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073488 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_195|beg|1549|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| taaccTgggtgaacgaactTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaa | |||
| Protein-Sequence | |||
| NLGVAEPLVQRQGATRIVVRAAGVVQDTARAKE | |||
| Hit-Information Section | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 789 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 1876 to: 1902 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 204322 to: 204348 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 7883 to: 7909 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 12491 to: 12517 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987105 to: 987173 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972439 to: 972507 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439431 to: 439499 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755337 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617735 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204879 to: 2204947 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877808 to: 3877876 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279445 to: 3279513 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055770 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1406 to: 1474 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8284 to: 8352 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1514 to: 1582 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514219 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130227 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388804 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555428 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 940330 to: 940356 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301664 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846984 to: 2847052 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267861 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218287 to: 5218355 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110177 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275323 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 59208 to: 59234 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 628594 to: 628620 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308575 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248342 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278150 to: 4278218 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420046 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2121 to: 2147 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512233 to: 3512301 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198306 to: 3198374 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695448 to: 2695516 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551351 to: 3551419 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804174 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392032 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983741 to: 2983809 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051559 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124419 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357933 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357068 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124131 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317406 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597524 to: 4597592 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968935 to: 969003 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887931 to: 887999 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172680 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40576 | |||
Coding-DNA |
|||
| tTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaa | |||
| Protein-Sequence | |||
| NLGVAEPLVQRQGATRIVVRAAGVVQDTARAKE | |||
| Hit-Information Section | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 789 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 787 to: 813 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 1876 to: 1902 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 204322 to: 204348 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 7883 to: 7909 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 12491 to: 12517 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987105 to: 987173 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972439 to: 972507 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439431 to: 439499 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755337 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617735 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204879 to: 2204947 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877808 to: 3877876 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279445 to: 3279513 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055770 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1406 to: 1474 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8284 to: 8352 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1514 to: 1582 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514219 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130227 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388804 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555428 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 940330 to: 940356 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301664 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846984 to: 2847052 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267861 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218287 to: 5218355 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110177 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275323 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 59208 to: 59234 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 628594 to: 628620 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308575 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248342 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278150 to: 4278218 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420046 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2121 to: 2147 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512233 to: 3512301 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198306 to: 3198374 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695448 to: 2695516 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551351 to: 3551419 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804174 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392032 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983741 to: 2983809 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051559 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124419 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357933 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357068 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124131 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317406 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597524 to: 4597592 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968935 to: 969003 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887931 to: 887999 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172680 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40576 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_198|beg|2195|length|106|forward|gi | ||
| Query_DNA-Sequence | |||
| gatatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| atatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatg | |||
| Protein-Sequence | |||
| YGYFRPVFGVWLAVMLFTVLYYRKFGMIANIALM | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287938 to: 288006 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438768 to: 438836 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755932 to: 756000 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618330 to: 618398 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1479 to: 1547 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694853 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125481 | |||
Coding-DNA |
|||
| atatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatg | |||
| Protein-Sequence | |||
| YGYFRPVFGVWLAVMLFTVLYYRKFGMIANIALM | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287938 to: 288006 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438768 to: 438836 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755932 to: 756000 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618330 to: 618398 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1479 to: 1547 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694853 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125481 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_204|beg|1012|length|113|forward|gi | ||
| Query_DNA-Sequence | |||
| taaagcgcaactctcccaaaaatccattgctcttgaaatggctcaatccttgttcgtttcaatgTatacggatacgcaaatcagcgcccgagatatcatcagtgaagcgttag | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_206|beg|2460|length|137|forward|gi | ||
| Query_DNA-Sequence | |||
| agcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaattacggcgatcattttgtttgccgttggtacaggggcggaTttaaaggcttcgcagtgacgctgtctat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaa | |||
| Protein-Sequence | |||
| QAIHQGYANAFSTIADANITT*L | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 9 from: 1624 to: 1686 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 288172 to: 288234 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 797462 to: 797524 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 364 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131118 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058966 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756228 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618626 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438540 to: 438602 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203988 to: 2204050 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361917 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273921 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667418 to: 1667480 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684074 to: 1684136 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733120 to: 1733182 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612646 to: 1612708 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881338 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493727 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244412 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728556 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694619 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636926 to: 1636988 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649341 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171049 to: 1171111 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239720 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125022 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511342 to: 3511404 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982850 to: 2982912 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550460 to: 3550522 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125310 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805065 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052450 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197415 to: 3197477 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524885 to: 2524947 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508502 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409037 to: 2409099 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205215 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13384 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284217 to: 2284279 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629413 to: 629475 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694183 to: 2694242 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480876 to: 1480938 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420946 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994878 to: 3994937 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852513 to: 1852572 | |||
Coding-DNA |
|||
| gcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaa | |||
| Protein-Sequence | |||
| QAIHQGYANAFSTIADANITT*L | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 9 from: 1624 to: 1686 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 288172 to: 288234 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 797462 to: 797524 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 364 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131118 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058966 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756228 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618626 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438540 to: 438602 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203988 to: 2204050 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361917 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273921 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667418 to: 1667480 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684074 to: 1684136 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733120 to: 1733182 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612646 to: 1612708 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881338 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493727 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244412 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728556 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694619 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636926 to: 1636988 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649341 | |||
| gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171049 to: 1171111 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239720 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125022 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511342 to: 3511404 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982850 to: 2982912 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550460 to: 3550522 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125310 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805065 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052450 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197415 to: 3197477 | |||
| gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1680 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524885 to: 2524947 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508502 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409037 to: 2409099 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205215 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13384 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284217 to: 2284279 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629413 to: 629475 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694183 to: 2694242 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480876 to: 1480938 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420946 | |||
| gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994878 to: 3994937 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852513 to: 1852572 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_207|beg|2213|length|133|forward|gi | ||
| Query_DNA-Sequence | |||
| tgtatttggggtatggtggcggtaatgctgtttacggttctttactaTccgtaagtttggcatgattgctaacatcgcactaaatggcgaacctcgtgttgatcattggcgtaatgtcgatgatccgggcgca | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_209|beg|1047|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaatggctcaatccttgttcgtttaatgatacgggatacgcaaatcagcgcccgagatatcTatcagtgaagcgTttaggtaaggataaaatcgtcgcgttaacctc | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_210|beg|2391|length|124|forward|gi | ||
| Query_DNA-Sequence | |||
| tggcgggtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaaatccgcagcaagcgattcatcaaggttaTcgctaacgcattcagtaccattgccgatgcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggcgggtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaaatccgcagcaagcgattcatcaaggttaTcgct | |||
| Protein-Sequence | |||
| WRVDANVLIFERIREELREGKNPQQAIHQGYR*R | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 288106 to: 288192 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797396 to: 797482 | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 1558 to: 1644 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438582 to: 438668 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 756100 to: 756186 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 236 to: 322 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204116 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1058838 to: 1058924 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130990 to: 131076 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618498 to: 618584 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480810 to: 1480896 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_211|beg|337|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| gtcgtaaccgcgaagtgccaccactacaaaaaagacaaagcctgatttcgtgcactgggttggattttgcgtggtaagccgTcTttgaattcacccctgtgcatcccaatagaaatcaacattaaac | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_218|beg|334|length|111|forward|gi | ||
| Query_DNA-Sequence | |||
| cgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattcTacccctgtgcatcccaat | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_219|beg|296|length|105|forward|gi | ||
| Query_DNA-Sequence | |||
| tgaagaccgttttgaccaatttgtagccgagttctacgcgctcgtaaccgcgaagtTgccaccactacaaaaaagacaaagcctgatttcgtgcactgggttgga | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_220|beg|2335|length|132|forward|gi | ||
| Query_DNA-Sequence | |||
| cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgcagcaag | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgca | |||
| Protein-Sequence | |||
| PGATMTLPGIAGIVLTVGMAVDANVLIFERIRERATRRKKSA | |||
| Hit-Information Section | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 176 to: 274 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130930 to: 131028 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553498 to: 553608 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058778 to: 1058876 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756040 to: 756138 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618438 to: 618536 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438630 to: 438728 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204078 to: 2204176 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 960056 to: 960157 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694629 to: 2694745 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337734 to: 337832 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 1439093 to: 1439191 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284289 to: 2284405 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802596 to: 2802694 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804531 to: 1804632 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902585 to: 1902683 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 2889124 to: 2889225 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480750 to: 1480848 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452910 to: 453032 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996466 to: 1996561 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244440 to: 3244538 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165387 to: 3165482 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069422 to: 1069517 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13018 to: 13131 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62956 to: 63051 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869506 to: 1869601 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125275 to: 1125370 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462310 to: 462426 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3000797 to: 3000898 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649369 to: 2649467 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503632 to: 1503730 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384702 to: 384818 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153099 to: 1153197 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44727 to: 44822 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7486 to: 7599 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445720 to: 1445812 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694273 to: 2694365 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557422 to: 1557520 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922649 to: 1922744 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896503 to: 896598 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356845 to: 356940 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331849 to: 331947 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725263 to: 725361 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355482 to: 355580 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877001 to: 3877096 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 707 to: 802 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217477 to: 5217572 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540233 to: 1540328 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268736 to: 268834 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 4143485 to: 4143586 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3493755 to: 3493853 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3923096 to: 3923197 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3361945 to: 3362043 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309287 to: 1309382 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987882 to: 987977 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881366 to: 2881464 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728584 to: 2728682 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3810320 to: 3810421 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3273949 to: 3274047 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732994 to: 1733092 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667292 to: 1667390 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249054 to: 1249149 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683948 to: 1684046 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612520 to: 1612618 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277343 to: 4277438 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056479 to: 1056574 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333275 to: 1333370 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636800 to: 1636898 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 599 to: 694 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7477 to: 7572 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824754 to: 1824849 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514931 to: 1515026 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244335 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428796 to: 1428891 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724045 to: 5724140 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239748 to: 3239846 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973216 to: 973311 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78892 to: 79005 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389516 to: 1389611 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556140 to: 1556235 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072568 to: 1072660 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 832400 to: 832498 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217110 to: 1217205 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237423 to: 3237533 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620967 to: 1621059 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939547 to: 939639 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1085942 to: 1086040 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41282 to: 41395 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852603 to: 1852695 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268564 to: 1268656 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1156308 to: 1156406 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 834301 to: 834399 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420764 to: 1420856 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1124954 to: 1125052 | |||
| gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 1 from: 1573 to: 1671 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240444 to: 2240536 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695342 to: 2695437 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084318 to: 1084413 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217903 to: 2217995 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244410 to: 2244502 | |||
| gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 1 from: 1651 to: 1749 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 830645 to: 830743 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1125003 to: 1125101 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596738 to: 4596830 | |||
| gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591894 to: 591995 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1341 to: 1439 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209272 to: 209373 | |||
| gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282781 to: 1282882 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636748 to: 1636855 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549794 to: 549898 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883664 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045593 to: 1045706 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777346 to: 4777447 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709721 to: 1709813 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169208 to: 2169303 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920562 to: 1920657 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056492 to: 2056593 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401477 to: 401572 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492802 to: 1492897 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278638 to: 3278730 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534117 to: 1534212 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650961 to: 1651056 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841186 to: 1841281 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71984 to: 72079 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156360 to: 156455 | |||
| gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144060 to: 144152 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208203 to: 1208298 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435409 to: 435504 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268936 to: 1269031 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377899 to: 3377994 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577159 to: 577254 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236340 to: 1236435 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043489 to: 1043584 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572028 to: 572123 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618782 to: 4618874 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224472 to: 4224564 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029103 to: 1029198 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3256968 to: 3257060 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026518 to: 1026613 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001426 to: 2001518 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013764 to: 3013856 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152867 to: 1152962 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745360 to: 745452 | |||
| gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8408 to: 8500 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887344 to: 2887439 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939467 to: 1939559 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017504 to: 1017596 | |||
| gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1204 to: 1296 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65030 to: 65122 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243403 to: 5243495 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989637 to: 2989729 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094509 to: 3094601 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115830 to: 3115922 | |||
| gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1531 to: 1626 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905665 to: 905754 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924365 to: 1924460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734837 to: 734932 | |||
| gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44773 to: 44868 | |||
| gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190689 to: 190778 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131767 to: 2131859 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496618 to: 1496713 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994261 to: 1994356 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745852 to: 7745947 | |||
| gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244251 to: 244346 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560684 to: 1560779 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941568 to: 941663 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401937 to: 2402032 | |||
| gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660917 to: 661033 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183387 to: 183482 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598086 to: 1598181 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575527 to: 1575622 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629540 to: 1629635 | |||
| gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331462 to: 331578 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401872 to: 401970 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978544 to: 978642 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13805 to: 13897 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081118 to: 1081213 | |||
| gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107230 to: 2107325 | |||
| gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438200 to: 2438295 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207049 to: 2207141 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10420 to: 10512 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834637 to: 1834732 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110880 to: 1110978 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869343 to: 2869438 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276026 to: 1276124 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56230 to: 56328 | |||
| gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224726 to: 2224821 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122463 to: 122558 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1492 to: 1590 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 673351 to: 673446 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804327 to: 1804440 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476927 to: 1477022 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143860 to: 143955 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715193 to: 715285 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833411 to: 833500 | |||
| gi-nr: gi|152933790 gi_def: Clostridium botulinum F str. Langeland, complete genome hsp_num: 1 from: 3290067 to: 3290159 | |||
| gi-nr: gi|152930382 gi_def: Clostridium botulinum A str. Hall, complete genome hsp_num: 1 from: 3121081 to: 3121173 | |||
| gi-nr: gi|152926829 gi_def: Clostridium botulinum A str. ATCC 19397, complete genome hsp_num: 1 from: 3223665 to: 3223757 | |||
| gi-nr: gi|148287495 gi_def: Clostridium botulinum A str. ATCC 3502 complete genome hsp_num: 1 from: 3251325 to: 3251417 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 800234 to: 800323 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 801783 to: 801872 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 805035 to: 805124 | |||
| gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358049 to: 1358141 | |||
| gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048746 to: 1048838 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824113 to: 824202 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877817 to: 877906 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611208 to: 1611300 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 234524 to: 234619 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3049394 to: 3049489 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 233249 to: 233344 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415097 to: 2415189 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2611376 to: 2611471 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 1613 to: 1708 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 1452 to: 1547 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2102563 to: 2102658 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2631603 to: 2631698 | |||
| gi-nr: gi|152206095 gi_def: Clostridium kluyveri DSM 555, complete genome hsp_num: 1 from: 3199512 to: 3199607 | |||
| gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64740 to: 64835 | |||
| gi-nr: gi|41821838 gi_def: Treponema denticola ATCC 35405, complete genome hsp_num: 1 from: 719219 to: 719308 | |||
| gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4501 to: 4593 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395958 to: 396050 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241373 to: 1241465 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162569 to: 1162658 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 302325 to: 302417 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515261 to: 1515353 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63205 to: 63297 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176390 to: 176482 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45269 to: 45361 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301967 to: 302059 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533068 to: 533160 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3532129 to: 3532221 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 976493 to: 976585 | |||
| gi-nr: gi|33236383 gi_def: Chlamydophila pneumoniae TW-183, section 3 of 4 of the complete genome hsp_num: 1 from: 47529 to: 47621 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 190103 to: 190195 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 190226 to: 190318 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 651390 to: 651482 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 650711 to: 650803 | |||
| gi-nr: gi|25168256 gi_def: Clostridium acetobutylicum ATCC 824, complete genome hsp_num: 1 from: 2381304 to: 2381393 | |||
| gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 189347 to: 189439 | |||
| gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359104 to: 1359193 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887169 to: 887261 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 522884 to: 522976 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 873121 to: 873213 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2173347 to: 2173439 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 833087 to: 833179 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 520480 to: 520572 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3372341 to: 3372433 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3203518 to: 3203610 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3081587 to: 3081679 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1416746 to: 1416838 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765142 to: 2765234 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4984253 to: 4984342 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2922080 to: 2922172 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 525369 to: 525461 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 703619 to: 703711 | |||
| gi-nr: gi|149901357 gi_def: Clostridium beijerinckii NCIMB 8052, complete genome hsp_num: 1 from: 1811231 to: 1811326 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1825474 to: 1825560 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968173 to: 968265 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 191437 to: 191529 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 747818 to: 747910 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 800850 to: 800942 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 251674 to: 251766 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4260840 to: 4260932 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5168922 to: 5169014 | |||
Coding-DNA |
|||
| cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgca | |||
| Protein-Sequence | |||
| PGATMTLPGIAGIVLTVGMAVDANVLIFERIRERATRRKKSA | |||
| Hit-Information Section | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 176 to: 274 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130930 to: 131028 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553498 to: 553608 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058778 to: 1058876 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756040 to: 756138 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618438 to: 618536 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438630 to: 438728 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204078 to: 2204176 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 960056 to: 960157 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694629 to: 2694745 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337734 to: 337832 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 1439093 to: 1439191 | |||
| gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284289 to: 2284405 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802596 to: 2802694 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804531 to: 1804632 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902585 to: 1902683 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 2889124 to: 2889225 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480750 to: 1480848 | |||
| gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452910 to: 453032 | |||
| gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996466 to: 1996561 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244440 to: 3244538 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165387 to: 3165482 | |||
| gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069422 to: 1069517 | |||
| gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13018 to: 13131 | |||
| gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62956 to: 63051 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869506 to: 1869601 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125275 to: 1125370 | |||
| gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462310 to: 462426 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3000797 to: 3000898 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649369 to: 2649467 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503632 to: 1503730 | |||
| gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384702 to: 384818 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153099 to: 1153197 | |||
| gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44727 to: 44822 | |||
| gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7486 to: 7599 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445720 to: 1445812 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694273 to: 2694365 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557422 to: 1557520 | |||
| gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922649 to: 1922744 | |||
| gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896503 to: 896598 | |||
| gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356845 to: 356940 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331849 to: 331947 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725263 to: 725361 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355482 to: 355580 | |||
| gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877001 to: 3877096 | |||
| gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 707 to: 802 | |||
| gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217477 to: 5217572 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540233 to: 1540328 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268736 to: 268834 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 4143485 to: 4143586 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3493755 to: 3493853 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3923096 to: 3923197 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3361945 to: 3362043 | |||
| gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309287 to: 1309382 | |||
| gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987882 to: 987977 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881366 to: 2881464 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728584 to: 2728682 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3810320 to: 3810421 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3273949 to: 3274047 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732994 to: 1733092 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667292 to: 1667390 | |||
| gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249054 to: 1249149 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683948 to: 1684046 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612520 to: 1612618 | |||
| gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277343 to: 4277438 | |||
| gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056479 to: 1056574 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333275 to: 1333370 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636800 to: 1636898 | |||
| gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 599 to: 694 | |||
| gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410 | |||
| gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410 | |||
| gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7477 to: 7572 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824754 to: 1824849 | |||
| gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514931 to: 1515026 | |||
| gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244335 | |||
| gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428796 to: 1428891 | |||
| gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724045 to: 5724140 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239748 to: 3239846 | |||
| gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973216 to: 973311 | |||
| gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78892 to: 79005 | |||
| gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389516 to: 1389611 | |||
| gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556140 to: 1556235 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072568 to: 1072660 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 832400 to: 832498 | |||
| gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217110 to: 1217205 | |||
| gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237423 to: 3237533 | |||
| gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620967 to: 1621059 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939547 to: 939639 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1085942 to: 1086040 | |||
| gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41282 to: 41395 | |||
| gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852603 to: 1852695 | |||
| gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268564 to: 1268656 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1156308 to: 1156406 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 834301 to: 834399 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420764 to: 1420856 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1124954 to: 1125052 | |||
| gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 1 from: 1573 to: 1671 | |||
| gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240444 to: 2240536 | |||
| gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695342 to: 2695437 | |||
| gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084318 to: 1084413 | |||
| gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217903 to: 2217995 | |||
| gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244410 to: 2244502 | |||
| gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 1 from: 1651 to: 1749 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 830645 to: 830743 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1125003 to: 1125101 | |||
| gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596738 to: 4596830 | |||
| gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591894 to: 591995 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1341 to: 1439 | |||
| gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209272 to: 209373 | |||
| gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282781 to: 1282882 | |||
| gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636748 to: 1636855 | |||
| gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549794 to: 549898 | |||
| gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883664 | |||
| gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045593 to: 1045706 | |||
| gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777346 to: 4777447 | |||
| gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709721 to: 1709813 | |||
| gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169208 to: 2169303 | |||
| gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920562 to: 1920657 | |||
| gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056492 to: 2056593 | |||
| gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401477 to: 401572 | |||
| gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492802 to: 1492897 | |||
| gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278638 to: 3278730 | |||
| gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534117 to: 1534212 | |||
| gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650961 to: 1651056 | |||
| gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841186 to: 1841281 | |||
| gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71984 to: 72079 | |||
| gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156360 to: 156455 | |||
| gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144060 to: 144152 | |||
| gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208203 to: 1208298 | |||
| gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435409 to: 435504 | |||
| gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268936 to: 1269031 | |||
| gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377899 to: 3377994 | |||
| gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577159 to: 577254 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236340 to: 1236435 | |||
| gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043489 to: 1043584 | |||
| gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572028 to: 572123 | |||
| gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618782 to: 4618874 | |||
| gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224472 to: 4224564 | |||
| gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029103 to: 1029198 | |||
| gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3256968 to: 3257060 | |||
| gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026518 to: 1026613 | |||
| gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001426 to: 2001518 | |||
| gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013764 to: 3013856 | |||
| gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152867 to: 1152962 | |||
| gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745360 to: 745452 | |||
| gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8408 to: 8500 | |||
| gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887344 to: 2887439 | |||
| gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939467 to: 1939559 | |||
| gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017504 to: 1017596 | |||
| gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1204 to: 1296 | |||
| gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65030 to: 65122 | |||
| gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243403 to: 5243495 | |||
| gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989637 to: 2989729 | |||
| gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094509 to: 3094601 | |||
| gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115830 to: 3115922 | |||
| gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1531 to: 1626 | |||
| gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905665 to: 905754 | |||
| gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924365 to: 1924460 | |||
| gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734837 to: 734932 | |||
| gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44773 to: 44868 | |||
| gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190689 to: 190778 | |||
| gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131767 to: 2131859 | |||
| gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496618 to: 1496713 | |||
| gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994261 to: 1994356 | |||
| gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745852 to: 7745947 | |||
| gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244251 to: 244346 | |||
| gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560684 to: 1560779 | |||
| gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941568 to: 941663 | |||
| gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401937 to: 2402032 | |||
| gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660917 to: 661033 | |||
| gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183387 to: 183482 | |||
| gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598086 to: 1598181 | |||
| gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575527 to: 1575622 | |||
| gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629540 to: 1629635 | |||
| gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331462 to: 331578 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401872 to: 401970 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978544 to: 978642 | |||
| gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13805 to: 13897 | |||
| gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081118 to: 1081213 | |||
| gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107230 to: 2107325 | |||
| gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438200 to: 2438295 | |||
| gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207049 to: 2207141 | |||
| gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10420 to: 10512 | |||
| gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834637 to: 1834732 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110880 to: 1110978 | |||
| gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869343 to: 2869438 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276026 to: 1276124 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56230 to: 56328 | |||
| gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224726 to: 2224821 | |||
| gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122463 to: 122558 | |||
| gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1492 to: 1590 | |||
| gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 673351 to: 673446 | |||
| gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804327 to: 1804440 | |||
| gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476927 to: 1477022 | |||
| gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143860 to: 143955 | |||
| gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715193 to: 715285 | |||
| gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833411 to: 833500 | |||
| gi-nr: gi|152933790 gi_def: Clostridium botulinum F str. Langeland, complete genome hsp_num: 1 from: 3290067 to: 3290159 | |||
| gi-nr: gi|152930382 gi_def: Clostridium botulinum A str. Hall, complete genome hsp_num: 1 from: 3121081 to: 3121173 | |||
| gi-nr: gi|152926829 gi_def: Clostridium botulinum A str. ATCC 19397, complete genome hsp_num: 1 from: 3223665 to: 3223757 | |||
| gi-nr: gi|148287495 gi_def: Clostridium botulinum A str. ATCC 3502 complete genome hsp_num: 1 from: 3251325 to: 3251417 | |||
| gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 800234 to: 800323 | |||
| gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 801783 to: 801872 | |||
| gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 805035 to: 805124 | |||
| gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358049 to: 1358141 | |||
| gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048746 to: 1048838 | |||
| gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824113 to: 824202 | |||
| gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877817 to: 877906 | |||
| gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611208 to: 1611300 | |||
| gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 234524 to: 234619 | |||
| gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3049394 to: 3049489 | |||
| gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 233249 to: 233344 | |||
| gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415097 to: 2415189 | |||
| gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2611376 to: 2611471 | |||
| gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 1613 to: 1708 | |||
| gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 1452 to: 1547 | |||
| gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2102563 to: 2102658 | |||
| gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2631603 to: 2631698 | |||
| gi-nr: gi|152206095 gi_def: Clostridium kluyveri DSM 555, complete genome hsp_num: 1 from: 3199512 to: 3199607 | |||
| gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64740 to: 64835 | |||
| gi-nr: gi|41821838 gi_def: Treponema denticola ATCC 35405, complete genome hsp_num: 1 from: 719219 to: 719308 | |||
| gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4501 to: 4593 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395958 to: 396050 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241373 to: 1241465 | |||
| gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162569 to: 1162658 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 302325 to: 302417 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515261 to: 1515353 | |||
| gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63205 to: 63297 | |||
| gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176390 to: 176482 | |||
| gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45269 to: 45361 | |||
| gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301967 to: 302059 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533068 to: 533160 | |||
| gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3532129 to: 3532221 | |||
| gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 976493 to: 976585 | |||
| gi-nr: gi|33236383 gi_def: Chlamydophila pneumoniae TW-183, section 3 of 4 of the complete genome hsp_num: 1 from: 47529 to: 47621 | |||
| gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 190103 to: 190195 | |||
| gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 190226 to: 190318 | |||
| gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 651390 to: 651482 | |||
| gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 650711 to: 650803 | |||
| gi-nr: gi|25168256 gi_def: Clostridium acetobutylicum ATCC 824, complete genome hsp_num: 1 from: 2381304 to: 2381393 | |||
| gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 189347 to: 189439 | |||
| gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359104 to: 1359193 | |||
| gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887169 to: 887261 | |||
| gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 522884 to: 522976 | |||
| gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 873121 to: 873213 | |||
| gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2173347 to: 2173439 | |||
| gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 833087 to: 833179 | |||
| gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 520480 to: 520572 | |||
| gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3372341 to: 3372433 | |||
| gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3203518 to: 3203610 | |||
| gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3081587 to: 3081679 | |||
| gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1416746 to: 1416838 | |||
| gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765142 to: 2765234 | |||
| gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4984253 to: 4984342 | |||
| gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2922080 to: 2922172 | |||
| gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 525369 to: 525461 | |||
| gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 703619 to: 703711 | |||
| gi-nr: gi|149901357 gi_def: Clostridium beijerinckii NCIMB 8052, complete genome hsp_num: 1 from: 1811231 to: 1811326 | |||
| gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1825474 to: 1825560 | |||
| gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968173 to: 968265 | |||
| gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 191437 to: 191529 | |||
| gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 747818 to: 747910 | |||
| gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 800850 to: 800942 | |||
| gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 251674 to: 251766 | |||
| gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4260840 to: 4260932 | |||
| gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5168922 to: 5169014 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_223|beg|165|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| tgcaaaaattattcgaagtcatacctgcatcatctggatcctgtaacgaaatcctcggtgcacgcttgaatTactatccataaccctgcgttactaccaacgcttgatggaaagcattcgtaaagcgattgatgaagac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| aatcctcggtgcacgcttgaatTactatccataaccctgcgttactaccaacgcttgatggaaagcattcgtaaagcgattgatgaagac | |||
| Protein-Sequence | |||
| RNPRCTLELLSITLRYYQRLMESIRKAIDED | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753943 to: 753996 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440772 to: 440825 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616296 to: 616349 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056621 to: 1056674 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 164 to: 214 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1217 to: 1267 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1218 to: 1268 | |||
| gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 133 to: 186 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 582 to: 632 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490770 to: 490820 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490768 to: 490818 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 399874 to: 399924 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501330 to: 501380 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443111 to: 443161 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441522 to: 441572 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460014 to: 460064 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494629 to: 494679 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412233 to: 412283 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 2527022 to: 2527072 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 506315 to: 506365 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426363 to: 426413 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490931 to: 490981 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426363 to: 426413 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356637 to: 356687 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355772 to: 355822 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 2411174 to: 2411224 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390736 to: 390786 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316110 to: 316160 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316720 to: 316770 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108882 to: 1108932 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 203028 to: 203078 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6589 to: 6639 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 11197 to: 11247 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 58340 to: 58390 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128922 to: 128975 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156617 to: 1156670 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2848229 to: 2848279 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831666 to: 831719 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334794 to: 334847 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728208 to: 728261 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271681 to: 271734 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352583 to: 352636 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117310 to: 1117363 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554506 to: 1554559 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976546 to: 976596 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3643 to: 3696 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 335718 to: 335762 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 2 from: 267544 to: 267588 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627307 to: 627354 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 2 from: 1006 to: 1056 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 2 from: 1084 to: 1134 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1091074 to: 1091124 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 825560 to: 825610 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 829216 to: 829266 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1130134 to: 1130184 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1130085 to: 1130135 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 827315 to: 827365 | |||
| gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393442 to: 2393495 | |||
| gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108592 to: 2108645 | |||
| gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864464 to: 1864517 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245127 to: 245171 | |||
| gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 2 from: 422574 to: 422612 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_224|beg|2489|length|134|forward|gi | ||
| Query_DNA-Sequence | |||
| gcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtctTatcggtattttaacctctatTgtttac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtct | |||
| Protein-Sequence | |||
| LRRSFCLPLVQGLIKGFAVTLS | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 131155 to: 131187 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 4 from: 401 to: 433 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58269 to: 58301 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 2 from: 1072409 to: 1072441 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2447786 to: 2447839 | |||
Coding-DNA |
|||
| tacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtct | |||
| Protein-Sequence | |||
| LRRSFCLPLVQGLIKGFAVTLS | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 131155 to: 131187 | |||
| gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 4 from: 401 to: 433 | |||
| gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58269 to: 58301 | |||
| gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 2 from: 1072409 to: 1072441 | |||
| gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2447786 to: 2447839 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_225|beg|1398|length|115|forward|gi | ||
| Query_DNA-Sequence | |||
| aaaactaagctgcttctggagtcgaaacaTccgtgatatgacctttacgacttcagaatccgaTtggccgttttgtgctcgtggctaagtttaccgaagctTcgcttacaggaaa | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_226|beg|1396|length|108|forward|gi | ||
| Query_DNA-Sequence | |||
| gcaaactaagctgcttTctggagtcgaaacaccgtTgatatTgacctttacgacttcTagaatccgatggccgttttgtctcgtggctaagtttaccgaagctcgctt | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_228|beg|145|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| ctcattgcTgactgttacacttgcaaaaattattcgaagtcatcctgcatcatctggatcgcctgtaacgaaaatcctcggtgcacgcttgaatcttatccataacctgcgttactaccaacgcttg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tcattgcTgactgttacacttgcaaaaattattcgaagtcatcctgcatcatctggatcgcctgtaacgaaaatcctcggtgcacgcttgaatcttatccataacctgcgttactaccaacgcttg | |||
| Protein-Sequence | |||
| SLLTVTLAKIIRSHPASSGSPVTKILGARLNLIHNLRYYQRL | |||
| Hit-Information Section | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753907 to: 753963 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440805 to: 440861 | |||
| gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 128 to: 184 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616260 to: 616316 | |||
| gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 97 to: 153 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1181 to: 1237 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1182 to: 1238 | |||
| gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478663 to: 1478719 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206265 to: 2206321 | |||
| gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3495838 to: 3495894 | |||
| gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900513 to: 1900569 | |||
| gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804711 to: 2804767 | |||
| gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 546 to: 602 | |||
| gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 967 to: 1023 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490734 to: 490790 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490732 to: 490788 | |||
| gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399838 to: 399894 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501294 to: 501350 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443075 to: 443131 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441486 to: 441542 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273886 to: 1273942 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459978 to: 460034 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494593 to: 494649 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412197 to: 412253 | |||
| gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527052 to: 2527108 | |||
| gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506279 to: 506335 | |||
| gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555367 to: 2555423 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426327 to: 426383 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490895 to: 490951 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426327 to: 426383 | |||
| gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438857 to: 3438913 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356601 to: 356657 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355736 to: 355792 | |||
| gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411204 to: 2411260 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390700 to: 390756 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316074 to: 316130 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316750 to: 316806 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108846 to: 1108902 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056585 to: 1056641 | |||
| gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58370 to: 58426 | |||
| gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202992 to: 203048 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6553 to: 6609 | |||
| gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11161 to: 11217 | |||
| gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364016 to: 3364072 | |||
| gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276020 to: 3276076 | |||
| gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665263 to: 1665319 | |||
| gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241819 to: 3241875 | |||
| gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246510 to: 3246566 | |||
| gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681919 to: 1681975 | |||
| gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730964 to: 1731020 | |||
| gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610491 to: 1610547 | |||
| gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883438 to: 2883494 | |||
| gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730678 to: 2730734 | |||
| gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634769 to: 1634825 | |||
| gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831699 to: 831755 | |||
| gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334827 to: 334883 | |||
| gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728241 to: 728297 | |||
| gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271714 to: 271770 | |||
| gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352547 to: 352603 | |||
| gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117274 to: 1117330 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627259 to: 627327 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128886 to: 128942 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976510 to: 976566 | |||
| gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651444 to: 2651500 | |||
| gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168882 to: 1168938 | |||
| gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122710 to: 1122766 | |||
| gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513598 to: 3513654 | |||
| gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985106 to: 2985162 | |||
| gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552716 to: 3552772 | |||
| gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122998 to: 1123054 | |||
| gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802753 to: 802809 | |||
| gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050138 to: 1050194 | |||
| gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199671 to: 3199727 | |||
| gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848259 to: 2848315 | |||
| gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156650 to: 1156706 | |||
| gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3676 to: 3732 | |||
| gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554470 to: 1554526 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696828 to: 2696884 | |||
| gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505807 to: 1505863 | |||
| gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335682 to: 335738 | |||
| gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551257 to: 551313 | |||
| gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267508 to: 267564 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 140120 to: 140176 | |||
| gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 970 to: 1026 | |||
| gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417992 to: 1418048 | |||
| gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1048 to: 1104 | |||
| gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139630 to: 139686 | |||
| gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760776 to: 760832 | |||
| gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161467 to: 1161523 | |||
| gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091104 to: 1091160 | |||
| gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825524 to: 825580 | |||
| gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829180 to: 829236 | |||
| gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130164 to: 1130220 | |||
| gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130115 to: 1130171 | |||
| gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827279 to: 827335 | |||
| gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448002 to: 1448058 | |||
| gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245097 to: 245147 | |||
| gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822928 to: 1822978 | |||
| gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535205 to: 535261 | |||
| gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1239174 to: 1239230 | |||
| gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1513062 to: 1513118 | |||
| gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696375 to: 2696431 | |||
| gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163238 to: 3163294 | |||
| gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 300202 to: 300249 | |||
| gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393826 to: 393873 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_229|beg|1454|length|110|forward|gi | ||
| Query_DNA-Sequence | |||
| tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgtaaccgggtgaacg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgt | |||
| Protein-Sequence | |||
| SDGRFVLVAKFTEARLQEIRNYAVGAEHHYFA*P | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130048 to: 130119 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755161 to: 755229 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439539 to: 439607 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057896 to: 1057967 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617556 to: 617627 | |||
Coding-DNA |
|||
| tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgt | |||
| Protein-Sequence | |||
| SDGRFVLVAKFTEARLQEIRNYAVGAEHHYFA*P | |||
| Hit-Information Section | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130048 to: 130119 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755161 to: 755229 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439539 to: 439607 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057896 to: 1057967 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617556 to: 617627 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_233|beg|1040|length|139|forward|gi | ||
| Query_DNA-Sequence | |||
| gctcttgaaaatggctcaatccttgttcgtttcTaatgatacgggatacgcaaatcaTgcgcccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatat | |||
| Protein-Sequence | |||
| ARDIISEALGKDKIVALNLAPSTPY | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057536 to: 1057613 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754798 to: 754875 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439893 to: 439970 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617196 to: 617273 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205341 to: 2205418 | |||
Coding-DNA |
|||
| ccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatat | |||
| Protein-Sequence | |||
| ARDIISEALGKDKIVALNLAPSTPY | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057536 to: 1057613 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754798 to: 754875 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439893 to: 439970 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617196 to: 617273 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205341 to: 2205418 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_234|beg|2190|length|127|forward|gi | ||
| Query_DNA-Sequence | |||
| atatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatcat | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgt | |||
| Protein-Sequence | |||
| IDMGIQACIWGMVAVMLFTVLYYRKFGMIANIALMANLVL | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287902 to: 288024 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438872 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755896 to: 756018 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058634 to: 1058756 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618294 to: 618416 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204320 | |||
Coding-DNA |
|||
| tatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgt | |||
| Protein-Sequence | |||
| IDMGIQACIWGMVAVMLFTVLYYRKFGMIANIALMANLVL | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287902 to: 288024 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438872 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755896 to: 756018 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058634 to: 1058756 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618294 to: 618416 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204320 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_237|beg|708|length|102|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgaagataacgcttTacatcacaaTtcgagttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctaccaaaaggtcgctgaaa | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctacca | |||
| Protein-Sequence | |||
| ELNTNNEGCIKKDFVTAVLP | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057238 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440268 to: 440333 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754500 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205748 to: 2205813 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129327 to: 129389 | |||
Coding-DNA |
|||
| gttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctacca | |||
| Protein-Sequence | |||
| ELNTNNEGCIKKDFVTAVLP | |||
| Hit-Information Section | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057238 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440268 to: 440333 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754500 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205748 to: 2205813 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129327 to: 129389 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_239|beg|275|length|141|forward|gi | ||
| Query_DNA-Sequence | |||
| aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcgtggtaagcc | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| agcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcg | |||
| Protein-Sequence | |||
| SIRKAIDEDRFDQFVAEFYARRNREVPPLQKDQSLISCTGLDLR | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440706 to: 440798 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753970 to: 754062 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206169 to: 2206258 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129038 | |||
Coding-DNA |
|||
| agcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcg | |||
| Protein-Sequence | |||
| SIRKAIDEDRFDQFVAEFYARRNREVPPLQKDQSLISCTGLDLR | |||
| Hit-Information Section | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440706 to: 440798 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753970 to: 754062 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206169 to: 2206258 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129038 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_241|beg|1722|length|142|forward|gi | ||
| Query_DNA-Sequence | |||
| cggcagTcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcaagcattaccgTatgcaagctcaagcgccgacgaatatggtcgccca | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| ggcagTcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcaagcattaccgTatgcaagctcaagcgccgacgaatatggtcgccca | |||
| Protein-Sequence | |||
| RQSGRAPAGSEIKFDRNGRPVVLKKRVILGGSSITVCKLKRRRIWSP | |||
| Hit-Information Section | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287437 to: 287535 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204687 to: 2204785 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058169 to: 1058267 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755431 to: 755529 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439239 to: 439337 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617829 to: 617927 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_243|beg|390|length|129|forward|gi | ||
| Query_DNA-Sequence | |||
| ctgggttggatttgcgtggtaagccgcttgaattcaccctgtgcatcccaatagaatcaaacattaaacaacaataacttagaggcgtttctcaatgagtttaatttctgtagcaccatgccgcaggcg | |||
Coding-DNA-Entry-Section |
|||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_244|beg|1444|length|112|forward|gi | ||
| Query_DNA-Sequence | |||
| gacttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcactattttgcgtaac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| acttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgc | |||
| Protein-Sequence | |||
| LRISCKRASGKNLATSTKRPSDSEV | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 651 to: 713 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287199 to: 287261 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796489 to: 796551 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439513 to: 439581 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755187 to: 755255 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130083 to: 130142 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057925 to: 1057993 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617585 to: 617653 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204961 to: 2205023 | |||
Coding-DNA |
|||
| acttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgc | |||
| Protein-Sequence | |||
| LRISCKRASGKNLATSTKRPSDSEV | |||
| Hit-Information Section | |||
| gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 651 to: 713 | |||
| gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287199 to: 287261 | |||
| gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796489 to: 796551 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439513 to: 439581 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755187 to: 755255 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130083 to: 130142 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057925 to: 1057993 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617585 to: 617653 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204961 to: 2205023 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_246|beg|1778|length|131|forward|gi | ||
| Query_DNA-Sequence | |||
| cctgtggtgctgaaaagcgcgtgattctgggtggttcaaTgcattacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaacaagagtcagcg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| tacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaac | |||
| Protein-Sequence | |||
| CCRLRYRAKCSTCGRPYSSALELAS*C | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204646 to: 2204720 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 1235300 to: 1235332 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058234 to: 1058308 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130386 to: 130460 | |||
Coding-DNA |
|||
| tacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaac | |||
| Protein-Sequence | |||
| CCRLRYRAKCSTCGRPYSSALELAS*C | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204646 to: 2204720 | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 1235300 to: 1235332 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058234 to: 1058308 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130386 to: 130460 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_249|beg|955|length|130|forward|gi | ||
| Query_DNA-Sequence | |||
| ggcgcgtggcgcctctgttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaaTgcgcaactctcccaaaaatccattgctcttgTaaaatggctcaatccttgttcgtttcaatgatacgg | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gcgcgtggcgcctctgttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaaTgcgcaactctcccaaaaatccattgctcttgTaaaatggctcaatccttgttcgtttcaatgatacg | |||
| Protein-Sequence | |||
| ARGASVDMSTLDAVTDALNKCATLPKIHCSCKMAQSLFVSMIR | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 5 from: 617055 to: 617114 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754657 to: 754716 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440052 to: 440111 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1057395 to: 1057454 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129550 to: 129609 | |||
Coding-DNA |
|||
| gcgcgtggcgcctctgttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaaTgcgcaactctcccaaaaatccattgctcttgTaaaatggctcaatccttgttcgtttcaatgatacg | |||
| Protein-Sequence | |||
| ARGASVDMSTLDAVTDALNKCATLPKIHCSCKMAQSLFVSMIR | |||
| Hit-Information Section | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 5 from: 617055 to: 617114 | |||
| gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754657 to: 754716 | |||
| gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440052 to: 440111 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1057395 to: 1057454 | |||
| gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129550 to: 129609 | |||
Query-DNA-Entry-Section |
|||
| Query-DNA-Def | dare_250|beg|42|length|118|forward|gi | ||
| Query_DNA-Sequence | |||
| gtgatgccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgcagTcacataaaaccTgatacaacaccactggatTcctcattgcgac | |||
Coding-DNA-Entry-Section |
|||
Coding-DNA |
|||
| gccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgca | |||
| Protein-Sequence | |||
| CQRVTHVTVTYLLTGGVIKIRNA | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 8 from: 2206421 to: 2206453 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 8 from: 1056453 to: 1056485 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 6 from: 616128 to: 616160 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1049 to: 1081 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1050 to: 1082 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490602 to: 490634 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490600 to: 490632 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501162 to: 501194 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 442943 to: 442975 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441354 to: 441386 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1273754 to: 1273786 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 459846 to: 459878 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494461 to: 494493 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412065 to: 412097 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426195 to: 426227 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490763 to: 490795 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426195 to: 426227 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356469 to: 356501 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355604 to: 355636 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390568 to: 390600 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 315942 to: 315974 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 976378 to: 976410 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316906 to: 316938 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108714 to: 1108746 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6421 to: 6453 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 2 from: 139988 to: 140020 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 627139 to: 627171 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2696984 to: 2697013 | |||
Coding-DNA |
|||
| gccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgca | |||
| Protein-Sequence | |||
| CQRVTHVTVTYLLTGGVIKIRNA | |||
| Hit-Information Section | |||
| gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 8 from: 2206421 to: 2206453 | |||
| gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 8 from: 1056453 to: 1056485 | |||
| gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 6 from: 616128 to: 616160 | |||
| gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1049 to: 1081 | |||
| gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1050 to: 1082 | |||
| gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490602 to: 490634 | |||
| gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490600 to: 490632 | |||
| gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501162 to: 501194 | |||
| gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 442943 to: 442975 | |||
| gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441354 to: 441386 | |||
| gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1273754 to: 1273786 | |||
| gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 459846 to: 459878 | |||
| gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494461 to: 494493 | |||
| gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412065 to: 412097 | |||
| gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426195 to: 426227 | |||
| gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490763 to: 490795 | |||
| gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426195 to: 426227 | |||
| gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356469 to: 356501 | |||
| gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355604 to: 355636 | |||
| gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390568 to: 390600 | |||
| gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 315942 to: 315974 | |||
| gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 976378 to: 976410 | |||
| gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316906 to: 316938 | |||
| gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108714 to: 1108746 | |||
| gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6421 to: 6453 | |||
| gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 2 from: 139988 to: 140020 | |||
| gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 627139 to: 627171 | |||
| gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2696984 to: 2697013 | |||
|
|||